DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Bsg

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster


Alignment Length:455 Identity:87/455 - (19%)
Similarity:139/455 - (30%) Gaps:159/455 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FT--WYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGT 141
            ||  |.||:....:|.:....|.::|..:|.||::      ..|.|                   
  Fly   166 FTRAWLEQQQQQQQLPHQSHKLHKSHLGYGNASLS------GSQPW------------------- 205

  Fly   142 AYHLAVQGGSLIRI---------PP----VNQTIR--EGQTAFFHCVMKHPENSQASWYKDGVLL 191
              |.:..||.:.|:         ||    :.||:.  |..|..::....|| .:.|:..:..|||
  Fly   206 --HPSAGGGGIHRVYSATPPDFPPPRLNLLEQTVAPPEPPTILYNPNPTHP-TASATATETSVLL 267

  Fly   192 --------------QEVQDLVRRFYM----------------------------GPDGSLSIDP- 213
                          |:.|..:..|.:                            |.......|| 
  Fly   268 TTAHHHAHHQQQLQQQSQHTLNAFQLPLPPRPNPGQNERYQTYAPHYVPPVVVSGAGAGAGADPG 332

  Fly   214 -------TMMSDLGEYECKV------------RNSDGELQTAKAFLNIQYKAKVIYAPPEVFLP- 258
                   |.:|........:            ..:.|.:..|...:.:..:...::...:..|| 
  Fly   333 AGASGEQTTISAATSTRAMMGGGGGVAGAGFSAGASGPMLGAGGHMLMGGQGHQVHLQHQTLLPV 397

  Fly   259 --------------------YGQPAVLDCHFRANPPLKNLRWEKDG-LLFDSYNVPGVFYKM--N 300
                                ...|.||.|:.:...|...|.|:|:| .:.|..::.|.|..:  .
  Fly   398 KMDKLVPNYDNAEHQMKFYDIRSPLVLSCNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADE 462

  Fly   301 GSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVI---VLRPPIFSVTPKAIYIQKLGEAAELP 362
            ......|.|.|..|.|:|.      .||.|..|.||   |:|.|..:...:       ||...:.
  Fly   463 NKFIIDKTDTNDDGKYSCE------FDGVSKEIEVIARVVVRVPSNTAVVE-------GEKMSVT 514

  Fly   363 CEAIDRDGNNRPSIIWGRKDGQPLPA-DRFSLSGGN-------LTITGLVEGDRGIYECSATNEA 419
            |..:    ..:|.:.|...:.....| |||.|...:       ||:..:...|||.|:|...|.|
  Fly   515 CSVV----GTKPELTWTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA 575

  Fly   420  419
              Fly   576  575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 13/50 (26%)
Ig 43..131 CDD:299845 13/53 (25%)
I-set 153..242 CDD:254352 23/165 (14%)
Ig 157..242 CDD:299845 21/152 (14%)
Ig_2 252..337 CDD:290606 26/111 (23%)
IG_like 260..327 CDD:214653 18/69 (26%)
I-set 341..428 CDD:254352 20/87 (23%)
IGc2 356..419 CDD:197706 18/70 (26%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
BsgNP_723346.2 IG_like 420..497 CDD:214653 24/82 (29%)
Ig 423..497 CDD:299845 23/79 (29%)
IG_like 500..583 CDD:214653 20/87 (23%)
Ig 512..575 CDD:143165 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.