DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr14

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:199 Identity:42/199 - (21%)
Similarity:69/199 - (34%) Gaps:41/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLV-----RRFYMGP-----------D 206
            :|.:.:...:.:.||.:...:....||.:     :...||.     :..|.|.           |
  Fly    82 LNISTQLSSSVYLHCRVNDLQGKTVSWMR-----RRGDDLTLITFGQHTYSGDSRYSLEFEEPND 141

  Fly   207 GSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVI----YAPPEVFLPYGQPAVLDC 267
            ..|.|......|.|.|||:| :|...|........|....:::    .|.||.:...|....|.|
  Fly   142 WKLLIQFANERDEGPYECQV-SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQC 205

  Fly   268 ------H------FRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTP 320
                  |      :|..|.|.|....:.|:...:..:||   :....|:.|..:....|:|||..
  Fly   206 VISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPG---RALSRLYIANANRQDTGNYTCML 267

  Fly   321 YNDL 324
            .|::
  Fly   268 GNEI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 20/99 (20%)
Ig 157..242 CDD:299845 20/99 (20%)
Ig_2 252..337 CDD:290606 20/85 (24%)
IG_like 260..327 CDD:214653 18/77 (23%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 18/85 (21%)
Ig 84..169 CDD:299845 19/90 (21%)
IG_like 191..279 CDD:214653 20/84 (24%)
Ig 201..274 CDD:143165 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.