DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Fas2

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:829 Identity:176/829 - (21%)
Similarity:284/829 - (34%) Gaps:248/829 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VGSHVVFNCYIDFPFDAPIPYLV---HWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEF--- 105
            ||..::..|.   | ..|.|.||   .| |||:        ..:.....|||     |.|..   
  Fly    46 VGKPLILTCR---P-TVPEPSLVADLQW-KDNR--------NNTILPKPNGR-----NQPPMYTE 92

  Fly   106 ---GRA-SVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQ 166
               |.: ::.:|::.....|.|:|..|:.|.....:......::|:...:    .|.||....||
  Fly    93 TLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTN----APENQYPTLGQ 153

  Fly   167 TAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSD- 230
            .....|.:|...|....|.::|..::...|.    |:.....|.|.....||.|.|.|:....: 
  Fly   154 DYVVMCEVKADPNPTIDWLRNGDPIRTTNDK----YVVQTNGLLIRNVQESDEGIYTCRAAVIET 214

  Fly   231 GELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLF-----DSY 290
            |||......:.:..:.::|..|..:....|:|...:|..|.. |:..:.|.:|....     |.:
  Fly   215 GELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGK-PVPEISWIRDATQLNVATADRF 278

  Fly   291 NVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPI---FSVTPKAIYI 352
            .|    ....|.:..:.|.::..|:|||...|..|.......::|:| ||.|   ::||.     
  Fly   279 QV----NPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLV-RPQIYELYNVTG----- 333

  Fly   353 QKLGEAAELPCEAIDRDGNNRPSII---WGRKD----GQPLPADRFSL----------SGGNLTI 400
            .:..|.| :.|.|   .|...|:|.   ||.::    ||.....|..|          |.|.|.|
  Fly   334 ARTKEIA-ITCRA---KGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRI 394

  Fly   401 TGLVEGDRGIYECSATNEAAT------ITAE---------------------------------- 425
            :.....|.|:|:|.|.|:.|.      ||.|                                  
  Fly   395 SNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNA 459

  Fly   426 ----------------AELMIENIAPRA------------------------------------- 437
                            ..|.|....||:                                     
  Fly   460 TIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARV 524

  Fly   438 --------PYNLTANSTETCITIRWQPGYL-RPNLEYTVWYRLMEAPEWRTLRVLDKKVMEAT-- 491
                    |..|||  |.....||.....| .|.|.|:|.|:....|:|.|  ..::.....:  
  Fly   525 PDFVSEAKPSQLTA--TTMTFDIRGPSTELGLPILAYSVQYKEALNPDWST--AYNRSWSPDSPY 585

  Fly   492 -VQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQL----QHDLGQ--VTAP 549
             |:.|:|..||.|...::::.|.|.:...   |...:|.|:...:.:.|    |||..:  |.:|
  Fly   586 IVEGLRPQTEYSFRFAARNQVGLGNWGVN---QQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSP 647

  Fly   550 AGGLGAPWNLTAISNQQGWLLHWEHPVQGLEGLRLYAVRW---------WKEPEHF--LIGHAET 603
                          ....:.|.|..|....|.:..|.:::         |.|.|:.  .:...||
  Fly   648 --------------YSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMET 698

  Fly   604 FDNYYQLRHLKEDTLFKVQVL---AVGTETQQSVPSHELL-----IDV--PSQRKV--RALIIGS 656
              ..:::..|..:|.:::::.   |:|    .|.|:..::     |||  .::|:|  .|.|:|.
  Fly   699 --TSFEMTQLVGNTYYRIELKAHNAIG----YSSPASIIMKTTRGIDVIQVAERQVFSSAAIVGI 757

  Fly   657 SVG-------VIFLLCALCAFLYVKRSCLRHLFAKDSSASEDEDTAESG 698
            ::|       |:.|||.:...:.|..:..|.  || .|.||.:|.|:.|
  Fly   758 AIGGVLLLLFVVDLLCCITVHMGVMATMCRK--AK-RSPSEIDDEAKLG 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 22/90 (24%)
Ig strand C 69..72 CDD:409512 1/5 (20%)
Ig strand E 108..112 CDD:409512 0/4 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 22/89 (25%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 1/3 (33%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 17/79 (22%)
Ig 341..428 CDD:472250 30/162 (19%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 2/7 (29%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 2/52 (4%)
FN3 435..524 CDD:238020 26/137 (19%)
FN3 554..636 CDD:238020 15/95 (16%)
Fas2NP_001284854.1 Ig 33..121 CDD:472250 23/92 (25%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 66..70 CDD:409353 1/4 (25%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 19/77 (25%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 19/94 (20%)
Ig strand A 229..232 CDD:409568 0/2 (0%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/7 (14%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 1/9 (11%)
IG_like 330..424 CDD:214653 27/102 (26%)
Ig strand B 339..343 CDD:409353 1/4 (25%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 4/67 (6%)
Ig strand B 447..451 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 0/3 (0%)
Ig strand F 501..506 CDD:409353 0/4 (0%)
FN3 525..619 CDD:238020 25/100 (25%)
FN3 640..735 CDD:238020 18/114 (16%)

Return to query results.
Submit another query.