DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and rst

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:486 Identity:108/486 - (22%)
Similarity:177/486 - (36%) Gaps:104/486 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LALLAIILLMNISCTSAARDHRR-------QTNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKD 74
            |.|||.|:.|..|....:..::|       ||   |.||:.|...|.:     ......:.||||
  Fly     7 LLLLATIVGMVRSSPYTSYQNQRFAMEPQDQT---AVVGARVTLPCRV-----INKQGTLQWTKD 63

  Fly    75 NKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVS-FPNRSPSVRN 138
            :..:.|       :.:|.....:.:....|.|..|:::..:...|...|.|||| .|...|::| 
  Fly    64 DFGLGT-------SRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIR- 120

  Fly   139 NGTAYHLAVQGGSLIRIPPVNQTIREGQTAF--------FHCVMKHPENSQASWYKDG---VLLQ 192
                   :...|..:.:||....|.:|...:        ..||....:.:....:.||   ||..
  Fly   121 -------STFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTD 178

  Fly   193 EVQDLV------RRFYMGPDGSLSIDPTMMSDLGEYECKVRN-SDGELQTAKAFLNIQY----KA 246
            .::..|      |||  .....|.:.|........:.|:.:| :|...::||..:.::|    |.
  Fly   179 NIEYTVIPLPDQRRF--TAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKV 241

  Fly   247 KVIYAPP-------------EVFLPYGQPAV------LDCHFRANPPLKNLRWEKDGLLFDSYNV 292
            .|:.:.|             .|.:..|...|      |:|...|||.....||    .:.|...:
  Fly   242 NVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRW----FINDEPII 302

  Fly   293 PGVFYKM---NGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQK 354
            .|...:|   |.:..|      |.....|...|.:|....|..:.:..  .|.|...|:::... 
  Fly   303 GGQKTEMVIRNVTRKF------HDAIVKCEVQNSVGKSEDSETLDISY--APSFRQRPQSMEAD- 358

  Fly   355 LGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFSLSGGNLTITGLVEGDRGIYECSATNEA 419
            :|....|.||.   |.|.:|.|:|.:.     |:||...:..|||.: :.....|.|.|.|....
  Fly   359 VGSVVSLTCEV---DSNPQPEIVWIQH-----PSDRVVGTSTNLTFS-VSNETAGRYYCKANVPG 414

  Fly   420 -ATITAEAELMIENI----APRAPYNLTANS 445
             |.|:|:|.:.::..    :.|..|.|..::
  Fly   415 YAEISADAYVYLKGSPAIGSQRTQYGLVGDT 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 18/85 (21%)
Ig 43..131 CDD:299845 20/88 (23%)
I-set 153..242 CDD:254352 21/106 (20%)
Ig 157..242 CDD:299845 20/102 (20%)
Ig_2 252..337 CDD:290606 21/106 (20%)
IG_like 260..327 CDD:214653 18/75 (24%)
I-set 341..428 CDD:254352 26/87 (30%)
IGc2 356..419 CDD:197706 19/62 (31%)
FN3 435..524 CDD:238020 3/11 (27%)
FN3 554..636 CDD:238020
rstNP_001284835.1 IG_like 34..130 CDD:214653 26/118 (22%)
Ig 42..114 CDD:299845 18/83 (22%)
C2-set_2 135..225 CDD:285423 17/91 (19%)
Ig_3 265..329 CDD:290638 16/73 (22%)
I-set 346..420 CDD:254352 24/83 (29%)
Ig 360..425 CDD:299845 23/73 (32%)
Ig5_KIRREL3-like 428..524 CDD:143235 3/18 (17%)
IG_like 435..524 CDD:214653 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.