DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and sdk

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster


Alignment Length:728 Identity:150/728 - (20%)
Similarity:255/728 - (35%) Gaps:197/728 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RQTNLEAKVGSHVV-FNCYIDFPFDAPIPYL-VHWTKDNKKIFTWYEQETSTSELFNGRLHLVEN 101
            |..:::.|||:.|| ..|..:   ..|:..| ..|.||...:      ||:      |..|.: |
  Fly   266 RPQDVKVKVGTGVVELQCIAN---ARPLHELETLWLKDGLAV------ETA------GVRHTL-N 314

  Fly   102 HPEFGRASVNLTAIRESDQGWYHCQV-----SFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQT 161
            .| :.|....|.| ..|..|.|.|||     .:|..|.|.|       |.:....|...|...:|
  Fly   315 DP-WNRTLALLQA-NSSHSGEYTCQVRLRSGGYPAVSASAR-------LQILEPPLFFTPMRAET 370

  Fly   162 IRE--GQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVR--RFYMGPDGSLSIDPTMMSDLGEY 222
            ..|  ||......|:..| ..|..|:::.   :.|...:.  |:.:..|.:|.|...::.|...:
  Fly   371 FGEFGGQVQLTCDVVGEP-TPQVKWFRNA---ESVDAHIESGRYTLNTDNTLVIKKLILDDAAMF 431

  Fly   223 ECKVRNSDGELQTAKAFLNIQYK------------------------------------------ 245
            :|...|..|| .:|..:|.::.|                                          
  Fly   432 QCLAINEAGE-NSASTWLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSESGSSDRRKEFR 495

  Fly   246 ---AKVIYAPPE-VFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKM----NGS 302
               |.::..||: |....|:.|.:.|. ....|..|:.|     :::...:..:..::    :|.
  Fly   496 FASAPIMELPPQNVTALDGKDATISCR-AVGSPNPNITW-----IYNETQLVDISSRVQILESGD 554

  Fly   303 LFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIV----LRPPIFSVTPKAIYIQKLGEAAELPC 363
            |..:.:....||.|.|...|:.|:......:||:|    ::||:.:..       .||..|.|.|
  Fly   555 LLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTV-------LLGLTATLQC 612

  Fly   364 EAIDRDGNNRPSIIWGRKDGQPLPADRFSLSG----GNLTITGLVEGDRGIYECSATNEAATITA 424
            : :..|.:...:|.|.|:.....|.......|    |.|.|..:...|.|.|.|..|:.....|.
  Fly   613 K-VSSDPSVPYNIDWYREGQSSTPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETR 676

  Fly   425 EAELMIENIAPRAPYNLTA----NSTETCITIRWQPGY--LRPNLEYTVWYR----LMEAPE--- 476
            .|.|.:..: |..|.|:..    ...:..|.:.|.||:  ..|..::.:..|    |...|:   
  Fly   677 AARLSVIEL-PFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELGPVPDPLL 740

  Fly   477 -WRT-LRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQL 539
             |.| |..:........:::|:....|:|.|.:.::.|:|..|:......||....:.       
  Fly   741 NWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSG------- 798

  Fly   540 QHDLGQVTAPAGGLGAPWNLTAISNQQGWLLHWEHPVQGLEGLRL--YAVRW---------W--- 590
                    .|.|.:|:..:::.|..|      |:.|::.....::  |.:|:         |   
  Fly   799 --------PPVGFVGSARSMSEIITQ------WQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQ 849

  Fly   591 ----KEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVLA-----VGT-------ETQQSVPSHEL 639
                :...:|||....|:.:|.            ||:.|     ||.       :|::.||... 
  Fly   850 NITNEAQRNFLIQELITWKDYI------------VQIAAYNNMGVGVYTEGSKIKTKEGVPEAP- 901

  Fly   640 LIDVPSQRKVRAL 652
                |:..||.|:
  Fly   902 ----PTNVKVEAI 910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 26/92 (28%)
Ig 43..131 CDD:299845 26/94 (28%)
I-set 153..242 CDD:254352 21/92 (23%)
Ig 157..242 CDD:299845 20/88 (23%)
Ig_2 252..337 CDD:290606 19/89 (21%)
IG_like 260..327 CDD:214653 14/70 (20%)
I-set 341..428 CDD:254352 22/90 (24%)
IGc2 356..419 CDD:197706 18/66 (27%)
FN3 435..524 CDD:238020 21/103 (20%)
FN3 554..636 CDD:238020 20/111 (18%)
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653 26/100 (26%)
Ig 280..343 CDD:299845 21/80 (26%)
IG_like 375..450 CDD:214653 18/79 (23%)
Ig 378..447 CDD:143165 15/73 (21%)
Ig 506..587 CDD:299845 16/86 (19%)
IG_like 506..587 CDD:214653 16/86 (19%)
I-set 592..682 CDD:254352 24/97 (25%)
Ig 595..682 CDD:299845 24/94 (26%)
FN3 686..789 CDD:238020 21/102 (21%)
FN3 798..893 CDD:238020 20/127 (16%)
FN3 901..1005 CDD:238020 4/15 (27%)
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.