DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and robo3

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_005172693.1 Gene:robo3 / 30770 ZFINID:ZDB-GENE-000209-4 Length:1424 Species:Danio rerio


Alignment Length:836 Identity:194/836 - (23%)
Similarity:287/836 - (34%) Gaps:256/836 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RDHRRQTNLEAKV--GSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLH 97
            ||..|||..:..|  |...|..|..  |...|.| .:.|.::|.|:....|:.|    :..|:| 
Zfish   164 RDDFRQTPSDVVVAAGEPAVMECIP--PRGHPEP-TISWKRNNVKVNDKDERIT----IRGGKL- 220

  Fly    98 LVENHPEFGRASVNLTAIRESDQGWYHC----QVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPV 158
            ::.|             .|:||.|.|.|    .|...:..|:        .|.|....:....||
Zfish   221 MISN-------------TRKSDAGMYVCVGTNMVGEKDSDPA--------ELVVFERPMFVRRPV 264

  Fly   159 NQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVR-RFYMGPDGSLSIDPTMMSDLGEY 222
            ||.:....|..|.|.::........|.|      |..:|.| ||.:..|.||.:......|.|.|
Zfish   265 NQVVLADDTVDFQCEVQGDPAPTIRWKK------EEGELPRGRFEIRADNSLRLTQVKAEDEGSY 323

  Fly   223 ECKVRNSDGELQTA---KAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDG 284
            .|...||.|:.:.:   :..:......:::..|.:.....|:.....|..:.||| ..:.|:|:|
Zfish   324 TCLSENSVGKAEASGSLQVHVGPSLPPQIVVRPRDQISAQGRTVTFLCGTKGNPP-PAVFWQKEG 387

  Fly   285 ---LLFDSY--NVPGVF-YKMNGSLFFAKVDENHAGSYTCTPYNDLGT----------DGPSPVI 333
               |||.|.  :..|.| ..::|.|....|....:|.|.|...:..|:          ..||..|
Zfish   388 SQVLLFPSQPPSQSGRFSVSLSGELTITDVHSEDSGYYICQAISVAGSILTKALLEVESTPSDRI 452

  Fly   334 SVIVLRPPIFSVTPKAIYIQKL--GEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPA--DRFSL- 393
                  |||....|..   |.|  |..|:|.|..:   ||..|||.|.| |||.:..  :|.|| 
Zfish   453 ------PPIIRQGPAN---QTLAPGTTAQLQCHVM---GNPLPSIQWER-DGQRILGIDERISLM 504

  Fly   394 SGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIE-----NIAP-RAPYNL--------TAN 444
            ..|.|.||.|.|.|.|.|.|.|::.:...:....|.::     :.:| ..||.|        ..:
Zfish   505 ENGTLQITALQETDSGAYTCVASSLSGETSWSGVLTVKESGGLSASPVSEPYQLPGPPQKPVVTD 569

  Fly   445 STETCITIRWQPGYLRPNLEYTVWYRLMEA------PEWRTLRVLD-KKVMEATVQHLQPGKEYE 502
            .|...:|:.|||.........|.:  ::||      ..|:|  |.| .|:.:.||..|.|...|.
Zfish   570 VTRNSVTLTWQPNAHEGGAAVTSY--IIEAFSQSAGSTWQT--VADFVKLEKHTVTGLSPNTIYL 630

  Fly   503 FMVLSQDKYGDGMFSKQFRFQTLPSPI----RADD-------FDAQQLQHDLGQ--------VTA 548
            |:|.:.:.||          .:.||||    |..|       .|.:|:|.:||:        |..
Zfish   631 FIVRAVNAYG----------LSDPSPISEPVRTQDVSPTGQGVDHRQVQRELGEMSVQLHEPVLL 685

  Fly   549 PAGGLGAPWNLTAISNQ-QGWLLHWEHPVQG--------------------LEG------LRLY- 585
            .|..:...||:...|.. ||:.|.: .||.|                    |:|      :|.| 
Zfish   686 TASSVKISWNVDRQSQYIQGYRLLY-RPVGGSWSQQEVKGATERSAVIANLLKGTEYEIKIRPYF 749

  Fly   586 ----------------------------------------AVRWWKEPEHFLIG----------- 599
                                                    :|.|...|.....|           
Zfish   750 NEFQGLDSRSQTLRTPEEVPSAPPRAVNVATVKLSNSSSISVSWQPPPTDMQNGVIQEYKVWCLG 814

  Fly   600 -HAETFDNYYQ----------LRHLKEDTLFKVQVLAV--------------------------- 626
             .::|..|..|          |:.|....|::|:|.||                           
Zfish   815 NDSQTRYNINQTVDGSVLSTVLKGLLPGVLYQVEVAAVTSAGVGKHSQPVSVLIKLPAEQPTVTG 879

  Fly   627 -GTETQQSVPSHELLIDVPSQRKVRALIIGSSVGVIFLLCALCAFLYVKRSCLRHL 681
             |:|::::|...|.:.||..|   .|.|.|.......:|.....::|.:|...:.|
Zfish   880 GGSESEENVSLAEQITDVVKQ---PAFIAGIGGACWVILMGFSVWIYCRRKKRKEL 932

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 21/91 (23%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/8 (25%)
Ig 153..242 CDD:472250 24/92 (26%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/5 (0%)
Ig_3 247..322 CDD:464046 21/80 (26%)
Ig 341..428 CDD:472250 33/91 (36%)
Ig strand B 359..363 CDD:409353 2/3 (67%)
Ig strand C 375..380 CDD:409353 3/4 (75%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 26/104 (25%)
FN3 554..636 CDD:238020 30/199 (15%)
robo3XP_005172693.1 IgC_1_Robo 63..161 CDD:409490
Ig strand A 63..67 CDD:409490
Ig strand A' 70..75 CDD:409490
Ig strand B 79..87 CDD:409490
Ig strand C 93..98 CDD:409490
Ig strand C' 101..103 CDD:409490
Ig strand D 114..117 CDD:409490
Ig strand E 120..126 CDD:409490
Ig strand F 138..146 CDD:409490
Ig strand G 149..161 CDD:409490
Ig 168..253 CDD:472250 27/113 (24%)
Ig strand B 182..186 CDD:409353 1/3 (33%)
Ig strand C 196..200 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 2/4 (50%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
IgI_3_Robo 260..342 CDD:409390 24/87 (28%)
Ig strand A 260..263 CDD:409390 0/2 (0%)
Ig strand A' 265..269 CDD:409390 2/3 (67%)
Ig strand B 272..281 CDD:409390 3/8 (38%)
Ig strand C 287..292 CDD:409390 1/4 (25%)
Ig strand C' 295..298 CDD:409390 0/2 (0%)
Ig strand D 301..306 CDD:409390 2/4 (50%)
Ig strand E 307..314 CDD:409390 3/6 (50%)
Ig strand F 321..329 CDD:409390 3/7 (43%)
Ig strand G 332..342 CDD:409390 1/9 (11%)
Ig 351..444 CDD:472250 22/93 (24%)
Ig strand B 367..371 CDD:409353 0/3 (0%)
Ig strand C 380..384 CDD:409353 0/3 (0%)
Ig strand E 410..414 CDD:409353 2/3 (67%)
Ig strand F 424..429 CDD:409353 2/4 (50%)
Ig strand G 437..440 CDD:409353 0/2 (0%)
Ig 455..541 CDD:472250 33/92 (36%)
Ig strand B 471..475 CDD:409353 2/3 (67%)
Ig strand C 484..488 CDD:409353 2/3 (67%)
Ig strand E 507..511 CDD:409353 2/3 (67%)
Ig strand F 521..526 CDD:409353 2/4 (50%)
FN3 <533..883 CDD:442628 68/364 (19%)
Ig strand G 534..537 CDD:409353 0/2 (0%)
FN3 559..653 CDD:238020 26/107 (24%)
Atrophin-1 1049..>1285 CDD:460830
Herpes_BLLF1 <1178..>1291 CDD:282904
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.