DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Fcgr3a

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_997486.2 Gene:Fcgr3a / 304966 RGDID:1303067 Length:249 Species:Rattus norvegicus


Alignment Length:185 Identity:47/185 - (25%)
Similarity:69/185 - (37%) Gaps:33/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYH 144
            |:..::.||....|..|   .:|.:   |:..:.:.|..|.|.|.||.:|...|..|:.:..|..
  Rat    49 TFSPEDNSTKWFHNKSL---ISHQD---ANYVIQSARVKDSGMYRCQTAFSALSDPVQLDVHADW 107

  Fly   145 LAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVL-LQEVQDLVRRFYMGPDGS 208
            |.:|        ...:..:||......|   |      ||....|. :..:|:...:.|...:..
  Rat   108 LLLQ--------TTKRLFQEGDPIRLRC---H------SWRNTPVFKVTYLQNGKGKKYFHRNSE 155

  Fly   209 LSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAP--PEVFLPYGQ 261
            |||.....:|.|.|.|  |...|....:.|.|.|.     |..|  |..|||:.|
  Rat   156 LSISKATHADSGSYFC--RGIIGRNNISSASLQIS-----IGDPTSPSSFLPWHQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 13/47 (28%)
Ig 43..131 CDD:299845 14/50 (28%)
I-set 153..242 CDD:254352 20/89 (22%)
Ig 157..242 CDD:299845 20/85 (24%)
Ig_2 252..337 CDD:290606 6/12 (50%)
IG_like 260..327 CDD:214653 1/2 (50%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Fcgr3aNP_997486.2 Ig1_FcgammaR_like 25..103 CDD:409410 16/59 (27%)
Ig strand B 42..46 CDD:409410
Ig strand C 56..60 CDD:409410 2/3 (67%)
Ig strand E 71..75 CDD:409410 1/3 (33%)
Ig strand F 85..90 CDD:409410 2/4 (50%)
Ig strand G 96..99 CDD:409410 1/2 (50%)
Ig2_FcgammaR_like 107..189 CDD:409411 23/105 (22%)
Ig strand B 123..127 CDD:409411 0/3 (0%)
Ig strand C 137..141 CDD:409411 0/3 (0%)
Ig strand E 154..158 CDD:409411 1/3 (33%)
Ig strand F 168..173 CDD:409411 2/6 (33%)
Ig strand G 182..185 CDD:409411 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.