DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Myot

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_006254728.1 Gene:Myot / 291605 RGDID:1310569 Length:497 Species:Rattus norvegicus


Alignment Length:466 Identity:96/466 - (20%)
Similarity:170/466 - (36%) Gaps:89/466 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILLMNISCTSAARDHRRQTNLEAKVGSHVVF--NCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQE 85
            |::....||      .::.:..:.|.||:..  :.|       |....:......:|:...|.| 
  Rat    40 IVIQPRQCT------EQRFSASSTVSSHITVSSSAY-------PASQQLAGPNPGQKVTATYNQ- 90

  Fly    86 TSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNG------TAYH 144
             |.:...:.   ::.:.|::..:.:..|.    |..:....|..|..:.|.:..|      |..|
  Rat    91 -SPASFLSS---ILPSQPDYSNSKIPSTV----DSNYQQSSVHQPVNAVSSQAAGAKPTPRTPDH 147

  Fly   145 LAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSL 209
             .:||.....|..:.:.::...|      :.|..|.:.::          ::.:.|..:||..:.
  Rat   148 -EIQGSKEALIQDLERKLKCKDT------LLHNGNQRLTY----------EEKMARRLLGPQNAA 195

  Fly   210 SIDPTMMSDLGEYECKVRNSDGELQ----------TAKAFLNIQ-------YKAKVIYAPPEVFL 257
            ::.....||:.:...:.......||          :::|..|.|       |..:.|..|..:.:
  Rat   196 AVFQAQNSDVQDSSQQHNPEHARLQVPTSQVRSRSSSRADANDQDAIQEKFYPPRFIQVPENMSI 260

  Fly   258 PYGQPAVLDCHFRANP-PLKNLRWEKDGLLFDSYNVPGVFYKMNG--SLFFAKVDENHAGSYTCT 319
            ..|:...:|  |:.:. |..::.|..:|.|..|..:..:.....|  ||.|..|..:.||.|.|.
  Rat   261 EEGRFCRMD--FKVSGLPAPDVSWYLNGRLVQSDELHKMIVSEKGFHSLIFEVVRASDAGPYACV 323

  Fly   320 PYNDLGTDGPSPVISVIV---LRPPIFSVTPKAIYIQKLGEAAELPCE--AIDRDGNNRPSIIWG 379
            ..|..|....:..:.|:.   .|.|:|...|::..:.: ||:.:|.|:  ||.     .|.:.|.
  Rat   324 ARNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVFE-GESVKLECQISAIP-----PPKLFWK 382

  Fly   380 RKDGQ-PLPADRFSLSGGN-----LTITGLVEGDRGIYECSATNEAATITAEAELMI---ENIAP 435
            |.:.. ....||.||...|     |.|..:.:.|.|.|..||.|||...|....|.:   .|..|
  Rat   383 RNNEMVQFNTDRISLYHDNAGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTP 447

  Fly   436 RAPYNLTANST 446
            .||..|....|
  Rat   448 PAPKQLRVRPT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 12/87 (14%)
Ig 43..131 CDD:299845 13/89 (15%)
I-set 153..242 CDD:254352 12/98 (12%)
Ig 157..242 CDD:299845 11/94 (12%)
Ig_2 252..337 CDD:290606 21/87 (24%)
IG_like 260..327 CDD:214653 19/69 (28%)
I-set 341..428 CDD:254352 28/94 (30%)
IGc2 356..419 CDD:197706 22/70 (31%)
FN3 435..524 CDD:238020 5/12 (42%)
FN3 554..636 CDD:238020
MyotXP_006254728.1 Ig 249..339 CDD:416386 21/91 (23%)
Ig strand A 249..252 CDD:409353 0/2 (0%)
Ig strand A' 255..260 CDD:409353 1/4 (25%)
Ig strand B 265..272 CDD:409353 2/8 (25%)
Ig strand C 279..285 CDD:409353 1/5 (20%)
Ig strand C' 286..289 CDD:409353 1/2 (50%)
Ig strand D 295..301 CDD:409353 0/5 (0%)
Ig strand E 304..314 CDD:409353 4/9 (44%)
Ig strand F 318..326 CDD:409353 3/7 (43%)
Ig strand G 328..339 CDD:409353 1/10 (10%)
IgI_Myotilin_C 348..439 CDD:409473 29/96 (30%)
Ig strand B 365..369 CDD:409473 1/3 (33%)
Ig strand C 378..382 CDD:409473 0/3 (0%)
Ig strand E 405..409 CDD:409473 1/3 (33%)
Ig strand F 419..424 CDD:409473 1/4 (25%)
Ig strand G 432..435 CDD:409473 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10075
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.