DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr7

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:245 Identity:51/245 - (20%)
Similarity:80/245 - (32%) Gaps:63/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 IPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFY----------MGPDGS- 208
            |.|.|.:....:.|...|.:|:..|...||.:.    :::..|....|          :.|.|| 
  Fly    56 ISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRK----RDLHILTTNIYTYTGDQRFSVIHPPGSE 116

  Fly   209 ---LSIDPTMMSDLGEYECKVR----------------NSDGELQTAKAFLNIQYKAKVIYAPPE 254
               |.||.....|.|.|||:|.                |...:|:|.|.|.:.:.....|....|
  Fly   117 DWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTE 181

  Fly   255 VFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGS---------------LF 304
            :.:.......|.|....:.|  ::.|.....:.|       |..:.|.               |.
  Fly   182 IHVKRDSTIALACSVNIHAP--SVIWYHGSSVVD-------FDSLRGGISLETEKTDVGTTSRLM 237

  Fly   305 FAKVDENHAGSYTCTPYNDLGTDGPSPV-ISVIVLRPPIFSVTPKAIYIQ 353
            ..:.....:|:|||.|...:    |:.| :.|:....|....|..||.|:
  Fly   238 LTRASLRDSGNYTCVPNGAI----PASVRVHVLTGEQPAAMQTSSAIRIR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 28/116 (24%)
Ig 157..242 CDD:299845 27/114 (24%)
Ig_2 252..337 CDD:290606 17/100 (17%)
IG_like 260..327 CDD:214653 13/81 (16%)
I-set 341..428 CDD:254352 5/13 (38%)
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr7NP_001096850.2 V-set 56..145 CDD:284989 23/92 (25%)
IG_like 58..140 CDD:214653 22/85 (26%)
IG_like 179..265 CDD:214653 16/98 (16%)
Ig 187..257 CDD:299845 13/78 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.