DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr1

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:199 Identity:48/199 - (24%)
Similarity:81/199 - (40%) Gaps:48/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDL------------VRRF-YMGPDGS 208
            |.|.|:..|||.|.||.::...:...||.:.       :||            .:|| .:.||||
  Fly    60 PRNLTVTVGQTGFLHCRVERLGDKDVSWIRK-------RDLHILTAGGTTYTSDQRFQVLRPDGS 117

  Fly   209 ----LSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHF 269
                |.|......|.|.|||:: |::.::..:..|..::.||: |:.|.::.:..|....|.|..
  Fly   118 ANWTLQIKYPQPRDSGVYECQI-NTEPKMSLSYTFNVV
ELKAE-IFGPSDLMVKTGSDINLTCKI 180

  Fly   270 RANP-PLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDEN-----------------HAGSY 316
            ...| .|.|:.|.|...:.|....    .:::.|:...:|:::                 ..|:|
  Fly   181 MQGPHELGNIFWYKGSEMLDGKGE----NEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNY 241

  Fly   317 TCTP 320
            ||.|
  Fly   242 TCVP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 28/101 (28%)
Ig 157..242 CDD:299845 28/101 (28%)
Ig_2 252..337 CDD:290606 17/87 (20%)
IG_like 260..327 CDD:214653 16/79 (20%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr1NP_001286645.1 Ig 59..154 CDD:299845 28/101 (28%)
IG_like 60..150 CDD:214653 27/97 (28%)
IG_like 163..257 CDD:214653 17/87 (20%)
Ig 174..244 CDD:143165 13/73 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.