DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr9

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:266 Identity:62/266 - (23%)
Similarity:90/266 - (33%) Gaps:72/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGG 150
            |.:|:|.:|          |.|.|::|                     ...||.|..:..|..  
  Fly   232 TFSSQLASG----------FHRNSIDL---------------------EEARNAGPYFDKAFS-- 263

  Fly   151 SLIRIPPVNQTIREGQTAFFHCVMKHPENS----QASW--YKDGVLL-----QEVQDLVRRFYMG 204
                   .|.|...|:||:.:|.:|:..|.    |.||  ::|..||     ....|...|....
  Fly   264 -------KNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQ 321

  Fly   205 P---DGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLD 266
            |   |..|.|......|.|.|||:|  |.....:....||:...:..|...|::::..|....|.
  Fly   322 PQTEDWMLQIKYPQHRDSGIYECQV--STTPHMSHYIHLNVVEPSTEIIGAPDLYIESGSTINLT 384

  Fly   267 CHFRANP-PLKNLRWEKDGLLFDS------YNVP--GVFYKMN------GSLFFAKVDENHAGSY 316
            |..:.:| |...:.|..:. .|.|      |:.|  ||....|      ..|.......:.:|.|
  Fly   385 CIIQNSPEPPAYIFWNHNN-AFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHY 448

  Fly   317 TCTPYN 322
            .|.|.|
  Fly   449 QCNPSN 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 8/41 (20%)
Ig 43..131 CDD:299845 8/44 (18%)
I-set 153..242 CDD:254352 28/102 (27%)
Ig 157..242 CDD:299845 28/98 (29%)
Ig_2 252..337 CDD:290606 20/86 (23%)
IG_like 260..327 CDD:214653 19/78 (24%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr9NP_001287332.1 Ig 263..361 CDD:299845 29/108 (27%)
IG_like 263..360 CDD:214653 28/107 (26%)
IG_like 371..464 CDD:214653 20/85 (24%)
IGc2 377..456 CDD:197706 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.