DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Bsg

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001103352.1 Gene:Bsg / 25246 RGDID:2220 Length:388 Species:Rattus norvegicus


Alignment Length:449 Identity:91/449 - (20%)
Similarity:162/449 - (36%) Gaps:109/449 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SALLALLAIILLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKI 78
            :|||..||...|......:||...:...:.|...|..||.:|.   ...:|:|.:..|.:.|   
  Rat     3 AALLLALAFTFLSGQGACAAAGFLKAPMSQEQWAGGSVVLHCE---AVGSPMPEIQWWFEGN--- 61

  Fly    79 FTWYEQETSTSELFNG----RLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSF-PNRS----- 133
                |...|.|:|::|    |:|:...:.:...:::::..:...|.|.|.|:.|. |:|:     
  Rat    62 ----EPNDSCSQLWDGARLDRVHIHATYRQHAASTLSVDGLAAEDTGTYECRASSDPDRNHLTRP 122

  Fly   134 PSVR-NNGTAYHLAVQGGSLIRIPPVNQTIREGQ-TAFFHC----VMKHPENSQASWYKDGVLLQ 192
            |.|: ....|..:.::.|::  :..|.:...:.| |.|.:.    ::.|      .|.:.|.:||
  Rat   123 PRVKWVRAQASVVVLEPGTI--VTSVQEVDSKTQLTCFLNSSGIDIVGH------RWMRGGKVLQ 179

  Fly   193 E--VQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEV 255
            |  :.||..::.:..|          ...|||.|.....    ...:..:|::...::.......
  Rat   180 EDTLPDLQMKYTVDAD----------DRSGEYSCIFLPE----PVGRGNINVEGPPRIKVGKKSE 230

  Fly   256 FLPYGQPAVLDCHFRA-NPPLKNLRWEK-----DGLLFDSYNVPGVFYKMN----GSLFFAKVDE 310
            ....|:...|.|...| :||:....|.|     |..:.:.......:..::    ..|..:.:|.
  Rat   231 HASEGEFVKLICKSEASHPPVDEWVWFKTSDTGDQTISNGTEANSKYVIISTPELSELIISDLDM 295

  Fly   311 N-HAGSYTCTPYNDLGTDGPS-------------P----VISVIVLRPPIFSVTPKAIYIQKLGE 357
            | ..|:|.|...|..|:...:             |    |..|:||...||      ||     |
  Rat   296 NVDPGTYVCNATNSQGSARETISLRVRSRLAALWPFLGIVAEVLVLVTIIF------IY-----E 349

  Fly   358 AAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFSLSGGNLTITGLVEGDRGIYECSAT 416
            ....|.:.:|.|.          ....||..     ||.:|.     :.|:.:.:.:||
  Rat   350 KRRKPDQTLDEDD----------PGAAPLKG-----SGSHLN-----DKDKNVRQRNAT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 20/89 (22%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 17/95 (18%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 0/3 (0%)
Ig strand F 221..226 CDD:409544 3/4 (75%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 15/85 (18%)
Ig 341..428 CDD:472250 16/76 (21%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 0/4 (0%)
Ig strand E 396..400 CDD:409353 1/3 (33%)
Ig strand F 410..415 CDD:409353 0/4 (0%)
Ig strand G 423..426 CDD:409353
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
BsgNP_001103352.1 Ig 23..138 CDD:472250 27/124 (22%)
Ig strand B 40..44 CDD:409353 2/3 (67%)
Ig strand C 53..57 CDD:409353 0/3 (0%)
Ig strand E 91..95 CDD:409353 0/3 (0%)
Ig strand F 105..110 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 0/2 (0%)
IG_like 228..321 CDD:214653 17/92 (18%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 270..290 CDD:409353 1/19 (5%)
Ig strand F 301..306 CDD:409353 2/4 (50%)
Ig strand G 314..317 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..388 8/52 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.