DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Ncam1

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus


Alignment Length:708 Identity:160/708 - (22%)
Similarity:258/708 - (36%) Gaps:156/708 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEF 105
            |..|.|.|...|..|.:    .:.:|..:.|....:.:.  .:::.....|.|..|         
  Rat   125 TPQEFKEGEDAVIVCDV----VSSLPPTIIWKHKGRDVI--LKKDVRFIVLSNNYL--------- 174

  Fly   106 GRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPP--------VNQTI 162
                 .:..|:::|:|.|.|:       ..:...|......:|  .::.:||        ||.|.
  Rat   175 -----QIRGIKKTDEGTYRCE-------GRILARGEINFKDIQ--VIVNVPPTVQARQSIVNATA 225

  Fly   163 REGQTAFFHCVMKHPENSQASWYKDGVLLQ-EVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKV 226
            ..||:....|..........||.|||..:: |.:|..:..:......|:|.....:|..||.|..
  Rat   226 NLGQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIA 290

  Fly   227 RNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRW----------- 280
            .|..|| |.|...|.:..|.|:.|...:..:...:...|.|. .:..|:.::.|           
  Rat   291 ENKAGE-QDASIHLKVFAKPKITYVENQTAMELEEQVTLTCE-ASGDPIPSITWRTSTRNISSEE 353

  Fly   281 -------EKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVL 338
                   ||...| |.:.|.....::: ||....:....||.|.||..|.:|.|..|..:.| ..
  Rat   354 KASWTRPEKQETL-DGHMVVRSHARVS-SLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEV-QY 415

  Fly   339 RPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPS--IIWGRKDGQPLPADRFS-------LS 394
            .|.:..  |.|:|..: |....:.||..     ..||  |.|.| |||.||:..:|       .|
  Rat   416 APKLQG--PVAVYTWE-GNQVNITCEVF-----AYPSATISWFR-DGQLLPSSNYSNIKIYNTPS 471

  Fly   395 GGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRA-------PYNLTA----NSTET 448
            ...|.:|...|.|.|.|.|:|.|.....:.|. ::::...|.:       ||:.||    :..|.
  Rat   472 ASYLEVTPDSENDFGNYNCTAVNRIGQESLEF-ILVQADTPSSPSIDRVEPYSSTAQVQFDEPEA 535

  Fly   449 CITIRWQPGYLRPNLEYTVWYRLMEAPEWRTLRVLDKKV--ME--ATVQHLQPGKEYEFMVLSQD 509
            ...:        |.|:|...::.:....|.: :..|.|.  ||  .|:..|:|...|...:.:.:
  Rat   536 TGGV--------PILKYKAEWKSLGEEAWHS-KWYDAKEANMEGIVTIMGLKPETRYAVRLAALN 591

  Fly   510 KYGDGMFSKQFRFQTLP--SPIRADDFDAQQLQHDLGQVTAPAGGLGAPWNLTAISNQQGWLLHW 572
            ..|.|..|....|:|.|  ||....:..|.:|:..:|:     .|.....||  |....|.    
  Rat   592 GKGLGEISAATEFKTQPVHSPPPQGEPSAPKLEGQMGE-----DGNSIKVNL--IKQDDGG---- 645

  Fly   573 EHPVQGLEGLRLYAVRW-------WKEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVLAVGTET 630
                   ..:|.|.|::       || ||..|    .:..::..|:.|..:..::|.|:|   |.
  Rat   646 -------SPIRHYLVKYRAKLASEWK-PEIRL----PSGSDHVMLKSLDWNAEYEVYVVA---EN 695

  Fly   631 QQ--SVPSHELL------IDVPSQRKVRA-LIIGSSVGVIFLLCAL--------CAFL 671
            ||  |..:|.:.      ..:|:.....| |..|:.||::.::..|        |.||
  Rat   696 QQGKSKAAHFVFRTSAQPTAIPANGSPTAGLSTGAIVGILIVIFVLLLVVMDITCYFL 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 15/85 (18%)
Ig 43..131 CDD:299845 15/87 (17%)
I-set 153..242 CDD:254352 27/97 (28%)
Ig 157..242 CDD:299845 26/93 (28%)
Ig_2 252..337 CDD:290606 21/102 (21%)
IG_like 260..327 CDD:214653 18/84 (21%)
I-set 341..428 CDD:254352 28/95 (29%)
IGc2 356..419 CDD:197706 24/71 (34%)
FN3 435..524 CDD:238020 22/103 (21%)
FN3 554..636 CDD:238020 21/90 (23%)
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand B 37..41 CDD:409451
Ig strand C 51..55 CDD:409451
Ig strand E 79..83 CDD:409451
Ig strand F 93..98 CDD:409451
Ig strand G 107..110 CDD:409451
IG_like 124..190 CDD:214653 15/84 (18%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 1/17 (6%)
Ig strand F 186..191 CDD:409353 2/11 (18%)
IgI_3_NCAM-1 211..308 CDD:143207 27/97 (28%)
Ig strand B 231..235 CDD:143207 0/3 (0%)
Ig strand C 244..248 CDD:143207 1/3 (33%)
Ig strand E 271..275 CDD:143207 1/3 (33%)
Ig strand F 285..290 CDD:143207 3/4 (75%)
Ig strand G 298..301 CDD:143207 1/2 (50%)
IgI_NCAM-1 307..413 CDD:143277 23/108 (21%)
Ig strand B 326..330 CDD:143277 1/3 (33%)
Ig strand C 339..343 CDD:143277 0/3 (0%)
Ig strand E 379..383 CDD:143277 2/4 (50%)
Ig strand F 393..398 CDD:143277 2/4 (50%)
Ig strand G 406..409 CDD:143277 0/2 (0%)
Ig_3 422..494 CDD:404760 26/78 (33%)
Ig strand B 433..437 CDD:409353 0/3 (0%)
Ig strand C 446..450 CDD:409353 1/3 (33%)
Ig strand E 473..477 CDD:409353 1/3 (33%)
Ig strand F 487..492 CDD:409353 2/4 (50%)
FN3 509..606 CDD:238020 22/105 (21%)
fn3 619..701 CDD:394996 24/107 (22%)
Herpes_BLLF1 <842..1133 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.