DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Lrit1

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_666357.2 Gene:Lrit1 / 239037 MGIID:2385320 Length:624 Species:Mus musculus


Alignment Length:427 Identity:90/427 - (21%)
Similarity:137/427 - (32%) Gaps:151/427 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 LRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPA---DRFSLSGGNLT 399
            |||.:.|:      |..||....|.|.|....|   |.:.|.|.:|:||..   ...|..|.:.|
Mouse   257 LRPGVTSI------ISPLGSTVLLRCGATGIPG---PEMSWRRANGRPLNGTVHQEVSSDGSSWT 312

  Fly   400 ITGLVE---GDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCITIRWQPGYLRP 461
            :..|..   .|.|.|.|.|.|    ....:|.:|..|       :|...|.|        ||  .
Mouse   313 LLDLPVVSLFDSGDYICQAKN----FLGASETLISLI-------VTEPQTST--------GY--S 356

  Fly   462 NLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQHL-----------QPGKEYEFMVLSQDKYGDGM 515
            .:...:|.|..|..|   ....:.|::...|.|:           .|..:.|..:.:......|.
Mouse   357 GIPGVLWARTGEGAE---AAAYNNKLVARHVPHMPEHVALATKPSMPSIKEELALQNFQMDVPGE 418

  Fly   516 FSKQFRFQTLPSPIRADDFDAQQLQ---------HDLGQV-TAPAGGLGAPWNLTAISNQQGWLL 570
            ||::      ||    :..:||.::         |.:..| .||..|     |.||.|       
Mouse   419 FSRE------PS----EHQEAQMVRSLKVVGDTYHSVSLVWKAPQAG-----NTTAFS------- 461

  Fly   571 HWEHPVQGLEGLRLYAVRWWKEPEHFLIGHAETFDNYYQLRHLKED---TLFKVQVLA------- 625
                        .||||          .||.:       :|.:..:   |...::.||       
Mouse   462 ------------VLYAV----------FGHRD-------MRRMTVEPGKTSVTIEGLAPKTKYVA 497

  Fly   626 -------VGTETQQSVPSHELLIDVPSQRKVRALIIGSSVGVIFL---LCALCAFL--------- 671
                   |.|:.|..:.|.:.::|....:::..:::.|...:|.|   |...|..|         
Mouse   498 CVCVRGLVPTKEQCVIFSTDEVVDAEGTQRLINMVVISVAAIIALPPTLLVCCGALRRRCHKCRT 562

  Fly   672 ---------YVKRSCLRHLFAKDSSASEDEDTAESGD 699
                     ||....|.|  ::|||......:...||
Mouse   563 GGSAEASGAYVNLERLGH--SEDSSEVLSRSSLSEGD 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352
Ig 157..242 CDD:299845
Ig_2 252..337 CDD:290606
IG_like 260..327 CDD:214653
I-set 341..428 CDD:254352 24/92 (26%)
IGc2 356..419 CDD:197706 21/68 (31%)
FN3 435..524 CDD:238020 17/99 (17%)
FN3 554..636 CDD:238020 17/98 (17%)
Lrit1NP_666357.2 LRRNT 23..61 CDD:214470
LRR 1 60..81
LRR_8 63..143 CDD:290566
leucine-rich repeat 64..84 CDD:275378
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..129
LRR_8 131..>176 CDD:290566
LRR_4 131..172 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378
TPKR_C2 201..>241 CDD:301599
Ig 258..346 CDD:299845 29/107 (27%)
IG_like 268..346 CDD:214653 25/91 (27%)
FN3 432..502 CDD:214495 19/110 (17%)
LRR 6 526..549 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.