Sequence 1: | NP_608822.1 | Gene: | bdl / 33635 | FlyBaseID: | FBgn0028482 | Length: | 719 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024309811.1 | Gene: | FCGR2B / 2213 | HGNCID: | 3618 | Length: | 324 | Species: | Homo sapiens |
Alignment Length: | 246 | Identity: | 56/246 - (22%) |
---|---|---|---|
Similarity: | 88/246 - (35%) | Gaps: | 57/246 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 GSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQP--------- 262
Fly 263 -AVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGT 326
Fly 327 DGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPL----- 386
Fly 387 ----PADRFSLSGGNLTITGLVEGDRGIYECSA-------TNEAATITAEA 426 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bdl | NP_608822.1 | IG_like | 42..128 | CDD:214653 | |
Ig | 43..131 | CDD:299845 | |||
I-set | 153..242 | CDD:254352 | 9/34 (26%) | ||
Ig | 157..242 | CDD:299845 | 9/34 (26%) | ||
Ig_2 | 252..337 | CDD:290606 | 20/94 (21%) | ||
IG_like | 260..327 | CDD:214653 | 16/76 (21%) | ||
I-set | 341..428 | CDD:254352 | 23/102 (23%) | ||
IGc2 | 356..419 | CDD:197706 | 17/78 (22%) | ||
FN3 | 435..524 | CDD:238020 | |||
FN3 | 554..636 | CDD:238020 | |||
FCGR2B | XP_024309811.1 | Ig1_FcgammaR_like | 50..128 | CDD:143229 | 18/91 (20%) |
Ig2_FcgammaR_like | 132..214 | CDD:319307 | 21/98 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |