DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and FCGR2A

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_011507589.1 Gene:FCGR2A / 2212 HGNCID:3616 Length:369 Species:Homo sapiens


Alignment Length:352 Identity:62/352 - (17%)
Similarity:115/352 - (32%) Gaps:92/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLG 220
            ||....::|..........:.||:....|:.:|.|:........||           ....:|.|
Human    47 PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRF-----------KANNNDSG 100

  Fly   221 EYECKVRNSDGELQTAKAFLNIQYKAKV-----IYAPPEVFLPYGQPAVLDCHFRANPPL----- 275
            ||.|         ||.:..|:......|     :...|.:....|:..:|.||...:.||     
Human   101 EYTC---------QTGQTSLSDPVHLTV
LSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTF 156

  Fly   276 -KNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCT-----------PYN------ 322
             :|.:.:|...|..::::|             :.:.:|:|.|.||           |..      
Human   157 FQNGKSQKFSHLDPTFSIP-------------QANHSHSGDYHCTGNIGYTLFSSKPVTITVQVP 208

  Fly   323 DLGTDGPSPVISVIVLRPPIFSVTPKA---IYIQKLGEAAEL--PCEAIDRDGNNRPSIIWGRKD 382
            .:|:..|..:|..:|:...:.::....   ||.:|...:|..  |.:|...:...|..|...::.
Human   209 SMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQ 273

  Fly   383 GQPLPADRFSLSGGNLTIT--GLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANS 445
            .:....|..:..||.:|:.  ...:.|:.||.....|:..                        :
Human   274 LEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHV------------------------N 314

  Fly   446 TETCITIRWQPGYLRPNLEYTVWYRLM 472
            |....|:.|.....:..|:....:||:
Human   315 TNKAFTLFWNTSCQKGKLQVNCQWRLL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 18/85 (21%)
Ig 157..242 CDD:299845 17/84 (20%)
Ig_2 252..337 CDD:290606 20/107 (19%)
IG_like 260..327 CDD:214653 17/89 (19%)
I-set 341..428 CDD:254352 16/93 (17%)
IGc2 356..419 CDD:197706 13/66 (20%)
FN3 435..524 CDD:238020 6/38 (16%)
FN3 554..636 CDD:238020
FCGR2AXP_011507589.1 Ig1_FcgammaR_like 41..119 CDD:143229 18/91 (20%)
IG_like 47..119 CDD:214653 18/91 (20%)
Ig2_FcgammaR_like 123..205 CDD:143230 17/94 (18%)
IG_like 129..205 CDD:214653 17/88 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.