DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and FCGR1A

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001365733.1 Gene:FCGR1A / 2209 HGNCID:3613 Length:375 Species:Homo sapiens


Alignment Length:410 Identity:87/410 - (21%)
Similarity:150/410 - (36%) Gaps:103/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SLIRIPPVNQTIREGQTAFFHCVMKH-PENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPT 214
            ::|.:.|...::.:.:|...||.:.| |.:|...|:.:|...|.           ...|..|...
Human    23 AVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQT-----------STPSYRITSA 76

  Fly   215 MMSDLGEYECKVRNSDG-----ELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPP 274
            .::|.|||.|: |...|     :|:..:.:|.:|..::|        ...|:|..|.||...:..
Human    77 SVNDSGEYRCQ-RGLSGRSDPIQLEIHRGWLLLQVSSRV--------FTEGEPLALRCHAWKDKL 132

  Fly   275 LKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCT-----PYNDLGTD------G 328
            :.|:.:.::|..|.       |:..|.:|...|.:.:|.|:|.|:     .|...|..      .
Human   133 VYNVLYYRNGKAFK-------FFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELF 190

  Fly   329 PSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEA---IDRDGNNRP-SIIWGRKDGQPLPAD 389
            |:||::..|..|.:            .|....|.||.   :.|.|.... |...|.|        
Human   191 PAPVLNASVTSPLL------------EGNLVTLSCETKLLLQRPGLQLYFSFYMGSK-------- 235

  Fly   390 RFSLSGGNLT-----ITGLVEGDRGIYECSATNEAATI---TAEAELMIENIAPRAP------YN 440
              :|.|.|.:     :|...| |.|:|.|.|..|...:   :.|.||.:..:....|      :.
Human   236 --TLRGRNTSSEYQILTARRE-DSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFY 297

  Fly   441 LTANSTETCITIRWQPGYLRPNLEYTVWYRLMEAPEWRTLRVLD----KKVMEATVQ--HLQPGK 499
            |.........|:.|          .|:...|....:|.....||    |||:.:..:  ||:  :
Human   298 LAVGIMFLVNTVLW----------VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLE--E 350

  Fly   500 EYEFMVLSQDKYGDGMFSKQ 519
            |.:.....:::..:|:..|:
Human   351 ELKCQEQKEEQLQEGVHRKE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 22/94 (23%)
Ig 157..242 CDD:299845 21/90 (23%)
Ig_2 252..337 CDD:290606 21/95 (22%)
IG_like 260..327 CDD:214653 18/71 (25%)
I-set 341..428 CDD:254352 21/98 (21%)
IGc2 356..419 CDD:197706 19/71 (27%)
FN3 435..524 CDD:238020 17/97 (18%)
FN3 554..636 CDD:238020
FCGR1ANP_001365733.1 Ig1_FcgammaR_like 23..101 CDD:409410 21/89 (24%)
Ig strand B 40..44 CDD:409410 0/3 (0%)
Ig strand C 54..58 CDD:409410 0/3 (0%)
Ig strand E 69..73 CDD:409410 1/3 (33%)
Ig strand F 83..88 CDD:409410 3/5 (60%)
Ig strand G 94..97 CDD:409410 0/2 (0%)
Ig2_FcgammaR_like 105..186 CDD:409411 21/95 (22%)
Ig strand B 121..125 CDD:409411 1/3 (33%)
Ig strand C 135..139 CDD:409411 1/3 (33%)
Ig strand E 152..156 CDD:409411 1/3 (33%)
Ig strand F 166..171 CDD:409411 2/4 (50%)
Ig strand G 179..182 CDD:409411 0/2 (0%)
ig 197..275 CDD:395002 22/100 (22%)
Interaction with EPB41L2. /evidence=ECO:0000269|PubMed:18023480 313..333 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..375 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.