DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and FCER1A

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001374209.1 Gene:FCER1A / 2205 HGNCID:3609 Length:257 Species:Homo sapiens


Alignment Length:201 Identity:52/201 - (25%)
Similarity:79/201 - (39%) Gaps:53/201 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PPVNQTIREGQTAFFHCVMKH-PENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDL 219
            ||.|: |.:|:.....|...: .|.|...|:.:|.|.:|.           :.||:|......|.
Human    36 PPWNR-IFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEET-----------NSSLNIVNAKFEDS 88

  Fly   220 GEYEC---KVRNSDG-ELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRW 280
            |||:|   :|..|:. .|:....:|.:|..|:|:..        |||..|.||          .|
Human    89 GEYKCQHQQVNESEPVYLEV
FSDWLLLQASAEVVME--------GQPLFLRCH----------GW 135

  Fly   281 EKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGT----------DGPSPVISV 335
            ..    :|.|.|  ::||...:|.:..  |||..|.|.....|.||          |..|..:::
Human   136 RN----WDVYKV--IYYKDGEALKYWY--ENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNI 192

  Fly   336 IVLRPP 341
            .|::.|
Human   193 TV
IKAP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 24/90 (27%)
Ig 157..242 CDD:299845 23/89 (26%)
Ig_2 252..337 CDD:290606 23/94 (24%)
IG_like 260..327 CDD:214653 21/76 (28%)
I-set 341..428 CDD:254352 1/1 (100%)
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
FCER1ANP_001374209.1 Ig1_FcgammaR_like 30..108 CDD:409410 23/83 (28%)
Ig strand B 47..51 CDD:409410 0/3 (0%)
Ig strand C 61..65 CDD:409410 0/3 (0%)
Ig strand E 76..80 CDD:409410 2/3 (67%)
Ig strand F 90..95 CDD:409410 3/4 (75%)
Ig strand G 101..104 CDD:409410 1/2 (50%)
Ig2_FcgammaR_like 112..194 CDD:409411 27/107 (25%)
Ig strand B 128..132 CDD:409411 1/3 (33%)
Ig strand C 142..146 CDD:409411 1/5 (20%)
Ig strand E 159..163 CDD:409411 1/3 (33%)
Ig strand F 173..178 CDD:409411 1/4 (25%)
Ig strand G 187..190 CDD:409411 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.