Sequence 1: | NP_608822.1 | Gene: | bdl / 33635 | FlyBaseID: | FBgn0028482 | Length: | 719 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001374209.1 | Gene: | FCER1A / 2205 | HGNCID: | 3609 | Length: | 257 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 52/201 - (25%) |
---|---|---|---|
Similarity: | 79/201 - (39%) | Gaps: | 53/201 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 PPVNQTIREGQTAFFHCVMKH-PENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDL 219
Fly 220 GEYEC---KVRNSDG-ELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRW 280
Fly 281 EKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGT----------DGPSPVISV 335
Fly 336 IVLRPP 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bdl | NP_608822.1 | IG_like | 42..128 | CDD:214653 | |
Ig | 43..131 | CDD:299845 | |||
I-set | 153..242 | CDD:254352 | 24/90 (27%) | ||
Ig | 157..242 | CDD:299845 | 23/89 (26%) | ||
Ig_2 | 252..337 | CDD:290606 | 23/94 (24%) | ||
IG_like | 260..327 | CDD:214653 | 21/76 (28%) | ||
I-set | 341..428 | CDD:254352 | 1/1 (100%) | ||
IGc2 | 356..419 | CDD:197706 | |||
FN3 | 435..524 | CDD:238020 | |||
FN3 | 554..636 | CDD:238020 | |||
FCER1A | NP_001374209.1 | Ig1_FcgammaR_like | 30..108 | CDD:409410 | 23/83 (28%) |
Ig strand B | 47..51 | CDD:409410 | 0/3 (0%) | ||
Ig strand C | 61..65 | CDD:409410 | 0/3 (0%) | ||
Ig strand E | 76..80 | CDD:409410 | 2/3 (67%) | ||
Ig strand F | 90..95 | CDD:409410 | 3/4 (75%) | ||
Ig strand G | 101..104 | CDD:409410 | 1/2 (50%) | ||
Ig2_FcgammaR_like | 112..194 | CDD:409411 | 27/107 (25%) | ||
Ig strand B | 128..132 | CDD:409411 | 1/3 (33%) | ||
Ig strand C | 142..146 | CDD:409411 | 1/5 (20%) | ||
Ig strand E | 159..163 | CDD:409411 | 1/3 (33%) | ||
Ig strand F | 173..178 | CDD:409411 | 1/4 (25%) | ||
Ig strand G | 187..190 | CDD:409411 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |