DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and HEPACAM

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_016872850.1 Gene:HEPACAM / 220296 HGNCID:26361 Length:468 Species:Homo sapiens


Alignment Length:499 Identity:102/499 - (20%)
Similarity:161/499 - (32%) Gaps:136/499 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKRSRTFRQSGSALLALLAIILLMNISCTSAARDHRRQTNLEAKVGSHVVFNC-YIDFPFDAPIP 66
            ::.||..|.:....|.|:....|..::.||..|      .:...||...:.:. |.....|.|: 
Human     9 SRASRALRLAPFVYLLLIQTDPLEGVNITSPVR------LIHGTVGKSALLSVQYSSTSSDRPV- 66

  Fly    67 YLVHWTKDNKKIFTWYEQETSTSEL------FNGRLHLVENHPEFGRASVNLTAIRESDQGWYHC 125
              |.|.....|..| ..|...|..:      :..|:.|.||      .|:.|:.::.:|:|.|..
Human    67 --VKWQLKRDKPVT-VVQSIGTEVIGTLRPDYRDRIRLFEN------GSLLLSDLQLADEGTYEV 122

  Fly   126 QVSFPNRSPSVRNNGTAYHLAVQGGSLIRIP---PVNQ--------TIREGQTAF-FHCVMKHPE 178
            ::|..:.:             ..|...|.:.   |:::        |:.|...|| .:|..::..
Human   123 EISITDDT-------------FTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGT 174

  Fly   179 NSQASWYKDG-VLLQEVQDLVRRFYMGPDGS-LSIDPTMMSDLGEYECKVRN--SDGELQTAKAF 239
            ....:|.||| .||.:     .|..:.||.. |:|...:|.|...|.|.|.|  |.|.....|..
Human   175 KPSYTWLKDGKPLLND-----SRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKIT 234

  Fly   240 LNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLF 304
            :..:....:|.:...:||......|..|...:....|.|.                  |.|...:
Human   235 VYRRSSLYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLE------------------KQNSLEY 281

  Fly   305 FAKVDENHAGSYTCTPYNDL-GTDGPSPVI------------------SVIVLRPPIFSVTPKAI 350
            ..:.|:.      ..|..:| .|..|.|..                  |...|.||    |.:.:
Human   282 MDQNDDR------LKPEGELPATQSPIPSTIRSVGCWEKAELGDKENSSAGTLPPP----TARRL 336

  Fly   351 Y-IQKLGEAAELPCEAIDRDG---NNRPSIIWGRKD-------GQPLPADRFSLSGG--NLTITG 402
            . .::.|:|..||     |.|   ...|..::..||       ..|.|..|.:...|  ..:::.
Human   337 QRRERFGQADTLP-----RSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPGPPGYSVSP 396

  Fly   403 LVEG-DRGI-------YECSATNEAATITAEAELMIENIAPRAP 438
            .|.| ..|:       |..|.....||....:.      .||||
Human   397 AVPGRSPGLPIRSARRYPRSPARSPATGRTHSS------PPRAP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 20/92 (22%)
Ig 43..131 CDD:299845 21/94 (22%)
I-set 153..242 CDD:254352 27/104 (26%)
Ig 157..242 CDD:299845 26/97 (27%)
Ig_2 252..337 CDD:290606 15/103 (15%)
IG_like 260..327 CDD:214653 9/67 (13%)
I-set 341..428 CDD:254352 22/107 (21%)
IGc2 356..419 CDD:197706 18/82 (22%)
FN3 435..524 CDD:238020 4/4 (100%)
FN3 554..636 CDD:238020
HEPACAMXP_016872850.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.