DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Iglon5

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:367 Identity:88/367 - (23%)
Similarity:136/367 - (37%) Gaps:89/367 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAKRSRTFRQSGSALLALLAII----LLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDFPFD 62
            ||..:| .|...:|.||.||:|    |..::..:|.|      .|.....|.:...:|:||....
Mouse     4 PAPGAR-LRLLAAAALAGLAVISRGLLSQSLEFSSPA------DNYTVCEGDNATLSCFIDEHVT 61

  Fly    63 APIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQV 127
            .     |.|...:..::...::.||     :.|:.|:.|.||  ..|:.:|.:...|:|.|.|  
Mouse    62 R-----VAWLNRSNILYAGNDRWTS-----DPRVRLLINTPE--EFSILITQVGLGDEGLYTC-- 112

  Fly   128 SFPNRSPSVRNNGTAYHLAVQGGSLIRIP--------PVNQTIREGQTAFFHCVMKHPENSQASW 184
            ||..|.....   |..:|      ::.:|        ||  .:.||......|:.........:|
Mouse   113 SFQTRHQPYT---TQVYL------IVHVPARIVNISSPV--AVNEGGNVNLLCLAVGRPEPTVTW 166

  Fly   185 --YKDGVL----LQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNS-DGELQTAKAFLNI 242
              .:||..    :.|:.|:.|                 ...|||||...|. :....:.:..:.:
Mouse   167 RQLRDGFTSEGEILEISDIQR-----------------GQAGEYECVTHNGVNSAPDSRRVLVTV 214

  Fly   243 QYKAKVIYAPPEVF------LPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGV---FYK 298
            .|       ||.:.      ...|:.|:|.|...|.|| .:.:|.||..|..|.:..|:   ..:
Mouse   215 NY-------PPTITDVTSARTALGRAALLRCEAMAVPP-ADFQWYKDDRLLSSGSAEGLKVQTER 271

  Fly   299 MNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRP 340
            ....|.||.|...|.|:|||...|.||...    .|:.:|||
Mouse   272 TRSMLLFANVSARHYGNYTCRAANRLGASS----ASMRLLRP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 20/85 (24%)
Ig 43..131 CDD:299845 21/87 (24%)
I-set 153..242 CDD:254352 18/103 (17%)
Ig 157..242 CDD:299845 17/91 (19%)
Ig_2 252..337 CDD:290606 28/93 (30%)
IG_like 260..327 CDD:214653 25/69 (36%)
I-set 341..428 CDD:254352 88/367 (24%)
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 25/110 (23%)
Ig strand A' 41..46 CDD:409353 1/4 (25%)
Ig strand B 48..56 CDD:409353 1/7 (14%)
CDR1 56..60 CDD:409353 2/3 (67%)
FR2 61..68 CDD:409353 2/11 (18%)
Ig strand C 61..67 CDD:409353 2/10 (20%)
CDR2 69..79 CDD:409353 0/9 (0%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 14/43 (33%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 4/9 (44%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 2/17 (12%)
FR4 122..129 CDD:409353 2/15 (13%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 16/83 (19%)
Ig strand A' 140..145 CDD:409353 2/6 (33%)
Ig strand B 148..157 CDD:409353 1/8 (13%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 5/7 (71%)
Ig_3 217..295 CDD:404760 24/78 (31%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.