DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and zig-3

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:223 Identity:54/223 - (24%)
Similarity:81/223 - (36%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 GEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDG 284
            ||....|.|...|:.:  ..|..:...|:|....:..:..|:...|.|.. .:.|...:.|||||
 Worm    20 GEMRAAVSNLVREIDS--THLTTKPSLKIIEGLEDNTVSTGESVTLRCDV-LSTPTGVIYWEKDG 81

  Fly   285 LLFDSYNVPGVFYK-------------MNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISV- 335
            ..........||.|             :..|......:.:|.|||.|...|...|...|..||| 
 Worm    82 QRIQGDKELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNGHDTVESSAKISVE 146

  Fly   336 --------IVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQ-PLPADRF 391
                    .....|:.:::.::.: :....||.|.|.| ||..|..    |..:|.: ...:.|:
 Worm   147 GQTVKCKSTRRSAPVITMSTESRF-ELQDNAATLICRA-DRRANWN----WMFEDKKIDFDSGRY 205

  Fly   392 S-LSGGNLTITGLVEGDRGIYECSATNE 418
            . |..|:|.|..:...|.|.|.|.|.|:
 Worm   206 ELLPSGDLLIRKIQWSDMGSYFCIAHNK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 6/21 (29%)
Ig 157..242 CDD:299845 6/21 (29%)
Ig_2 252..337 CDD:290606 24/106 (23%)
IG_like 260..327 CDD:214653 19/79 (24%)
I-set 341..428 CDD:254352 22/80 (28%)
IGc2 356..419 CDD:197706 21/65 (32%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
zig-3NP_509336.1 I-set 45..145 CDD:254352 24/100 (24%)
Ig 61..142 CDD:143165 20/81 (25%)
IG_like 177..244 CDD:214653 20/62 (32%)
Ig <191..237 CDD:299845 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.