DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and zig-2

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:220 Identity:56/220 - (25%)
Similarity:80/220 - (36%) Gaps:61/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNL 112
            |...|.:|..:   .||:| .::|..:..:|     |...||.::       ||....|:...|.
 Worm    47 GEKFVLSCGAN---GAPLP-SIYWELNGMRI-----QGEETSNVY-------ENILNDGKQVSNA 95

  Fly   113 TAIRESDQGWYHCQVSFPNRSP--SVRNNGTAYHLAVQGGSLIRIPPV----------NQTIREG 165
                        ..||...|.|  :.||:| ||...:..| |.::..|          |..:.:.
 Worm    96 ------------AMVSSHYRIPCATARNSG-AYKCIIDNG-LTKLEHVAKVFV
GGNKTNCALNDN 146

  Fly   166 QTAFFHCV----MKHPENSQA-----------SWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTM 215
            ...|....    ::...|:.|           ||:|...||....:   |:.|.|.|.|.|....
 Worm   147 GAPFISMTVDFRLEISNNAVALSCRSETATEWSWHKGEQLLTNDGE---RYQMFPSGDLIIRNIS 208

  Fly   216 MSDLGEYECKVRNSDGELQTAKAFL 240
            .||:|||.|..||..|| .||..||
 Worm   209 WSDMGEYNCTARNHFGE-TTAITFL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 15/79 (19%)
Ig 43..131 CDD:299845 17/82 (21%)
I-set 153..242 CDD:254352 30/113 (27%)
Ig 157..242 CDD:299845 30/109 (28%)
Ig_2 252..337 CDD:290606
IG_like 260..327 CDD:214653
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
zig-2NP_510069.1 I-set 34..134 CDD:254352 27/116 (23%)
Ig 34..121 CDD:299845 24/102 (24%)
Ig <179..232 CDD:299845 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.