DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and zig-11

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_503523.2 Gene:zig-11 / 189580 WormBaseID:WBGene00021305 Length:304 Species:Caenorhabditis elegans


Alignment Length:273 Identity:58/273 - (21%)
Similarity:92/273 - (33%) Gaps:99/273 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 QTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYEC 224
            ||:..|::.|...:   .||.:.:    |||..:|:          :|::...||....:...:.
 Worm    37 QTVIHGESLFSTDI---DENRKTT----GVLWCQVR----------EGTIHYKPTWARFVRIRDQ 84

  Fly   225 KVRNSDGELQTAKAFLNI---------QYKAKVIYAPPEVFL----PYGQPAVLDCHFRANPPLK 276
            |...:|..|...||:|:.         :|:.::......:.:    .|..|.|.:          
 Worm    85 KQFRADIGLDDDKAYLHFGQSKADASGKYRCEIKVPDNSIIIGNMFAYSHPVVKN---------- 139

  Fly   277 NLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPP 341
            |..||    |..|.:.|                                                
 Worm   140 NETWE----LKKSESEP------------------------------------------------ 152

  Fly   342 IFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPAD-RFSLSGGNLTITGLVE 405
             |:|...|:| ..|..||.:.|..:   |...|.|:| .||..||..: |...:.|.|:|.|..|
 Worm   153 -FTVVGPAVY-APLDSAARIQCPIV---GYPEPQIVW-YKDKFPLEIEGRVKFTAGVLSIEGAQE 211

  Fly   406 GDRGIYECSATNE 418
            .|.|:|.|.|||:
 Worm   212 EDAGVYRCEATNQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig strand C 69..72 CDD:409512
Ig strand E 108..112 CDD:409512
Ig strand F 122..127 CDD:409512
Ig 153..242 CDD:472250 19/81 (23%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 1/3 (33%)
Ig strand F 221..226 CDD:409544 0/4 (0%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 9/78 (12%)
Ig 341..428 CDD:472250 29/79 (37%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
zig-11NP_503523.2 Ig 166..225 CDD:472250 24/63 (38%)
Ig strand B 168..172 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 2/4 (50%)
Ig strand E 202..206 CDD:409353 2/3 (67%)
Ig strand F 216..221 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.