DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and zig-4

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:243 Identity:58/243 - (23%)
Similarity:89/243 - (36%) Gaps:55/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANP 273
            ::..|.|.:::......:.|   |:.|  .:|....|.|::.......:|.|:...|.|...:. 
 Worm    14 INAHPPMHAEMHSAVVTLAN---EIDT--NYLTSPAKIKIVAPLESALIPGGETYQLRCDIMST- 72

  Fly   274 PLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAK--VD---------------ENHAGSYTCTPY 321
            |...:.|:.:|.|....|...|..|:   |.|.|  ||               || :|:|:|..|
 Worm    73 PAATIHWKFNGKLIQGSNELNVEEKL---LNFGKAIVDTGIVASILTIQCPSAEN-SGTYSCVGY 133

  Fly   322 NDLGTDGPSPVISVIVLR---------------PPIFSVTPKAIYIQKLGEAAELPCEAIDRDGN 371
            |     |...:.:|..:.               |.|...|...  .:..|..|.|.|.|     |
 Worm   134 N-----GHQTIETVAEVEIEGEASGCRSNHKSAPEIVFWTDSR--FEMTGNVATLVCRA-----N 186

  Fly   372 NRPSIIWGRKDGQPLPADRFS-LSGGNLTITGLVEGDRGIYECSATNE 418
            .:...:|...|......|:|: ||.|:|.|..:|..|.|.|.|.|.|:
 Worm   187 QQVDWVWMSNDELVKNNDKFTVLSNGDLVIKNIVWDDMGTYTCIARNQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 6/32 (19%)
Ig 157..242 CDD:299845 6/32 (19%)
Ig_2 252..337 CDD:290606 25/101 (25%)
IG_like 260..327 CDD:214653 22/83 (27%)
I-set 341..428 CDD:254352 24/79 (30%)
IGc2 356..419 CDD:197706 22/64 (34%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
zig-4NP_509335.1 I-set 47..147 CDD:254352 26/109 (24%)
Ig 65..144 CDD:143165 23/88 (26%)
IG_like 176..245 CDD:214653 22/64 (34%)
Ig <193..238 CDD:299845 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.