DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and ncam-1

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_741709.1 Gene:ncam-1 / 180418 WormBaseID:WBGene00017184 Length:955 Species:Caenorhabditis elegans


Alignment Length:305 Identity:80/305 - (26%)
Similarity:120/305 - (39%) Gaps:60/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LAVQGGSLIRIPPVNQTI---REGQTAFFHCVMKH----PENSQASWYKDGVLLQEVQD--LVRR 200
            |.:..|..:.:.|..:.:   |.|......|.:|.    ..:::..||:||.|:.....  .:.|
 Worm    41 LLILSGWTLSLSPTEERLQNRRSGDNFLVVCKVKDFDGAASDAKIEWYRDGKLIPRFGSTMTIER 105

  Fly   201 FYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKA---------FLNIQYKAKVIYAPPEVF 256
            .|   ...|.|:...:||.|:|.||. ...||.|...|         |||:|....    |.|  
 Worm   106 TY---SNQLMINRPKISDGGKYTCKT-EIQGEQQEVSAEISFVDPPKFLNVQESQH----PEE-- 160

  Fly   257 LPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSL-----FFAKVDENHAGSY 316
               |..|.:.|.......|: :.|:.:|:..|..:..|..:..|..:     |.||.|:   |.|
 Worm   161 ---GTRAEIVCEVEGTDQLE-VFWQFNGVTLDETSQRGYEFSENNQILYIPHFTAKKDD---GIY 218

  Fly   317 TC--TPYNDLGTDGPSPVISVIV---LRPPI--FSVTPKAIYIQKLGEAAELPCEAIDRDGNNRP 374
            .|  ..|:...|      :||.|   .||.|  |.|......|:  |...||.|.|:   |..:|
 Worm   219 NCNAAQYSSFET------LSVNVTGYARPTITVFDVPNGNRGIE--GHTIELKCGAV---GKPKP 272

  Fly   375 SIIWGRKDGQ-PLP-ADRFSLSGGNLTITGLVEGDRGIYECSATN 417
            :..|..:|.: |:. :|:.::..|.|.|..|...|.|.|:|.|.|
 Worm   273 TYKWFFEDDEVPIARSDKHNVEEGLLIIESLNSEDAGTYKCVANN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 26/106 (25%)
Ig 157..242 CDD:299845 26/102 (25%)
Ig_2 252..337 CDD:290606 22/91 (24%)
IG_like 260..327 CDD:214653 17/73 (23%)
I-set 341..428 CDD:254352 25/81 (31%)
IGc2 356..419 CDD:197706 21/64 (33%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
ncam-1NP_741709.1 IG 64..142 CDD:214652 22/81 (27%)
Ig 69..140 CDD:143165 20/74 (27%)
IG_like 153..236 CDD:214653 23/101 (23%)
Ig 160..222 CDD:299845 17/70 (24%)
IG_like 256..330 CDD:214653 21/67 (31%)
IGc2 256..320 CDD:197706 21/67 (31%)
IG_like <445..499 CDD:214653
Ig <445..498 CDD:143165
IG_like 520..596 CDD:214653
IGc2 520..587 CDD:197706
FN3 <652..701 CDD:238020
FN3 <817..873 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.