DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and rig-6

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001022014.1 Gene:rig-6 / 173828 WormBaseID:WBGene00016354 Length:1196 Species:Caenorhabditis elegans


Alignment Length:706 Identity:159/706 - (22%)
Similarity:251/706 - (35%) Gaps:219/706 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EAKVGSHVVFNCYIDFPFDAPIPYLVHWTK-DNKKIFTWYEQETSTSELFNGRLHLVENHPEFGR 107
            :.|||..:...|   |.:.:|:|. ..|:: |.|.|              ..|.|:    ..:||
 Worm   361 DPKVGDSIYLEC---FAYASPLPQ-YKWSRVDGKPI--------------PARSHI----SNYGR 403

  Fly   108 ASVNLTAIRESDQGWYHCQV--SFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREG----- 165
            . :.:..:...|.|.|.|..  :|.:.:..|       |:.      :|.||   :|.:|     
 Worm   404 V-LKIEKVNYGDAGKYKCVAMNAFGSAAGEV-------HVK------LRAPP---SILQGLHDRL 451

  Fly   166 ----QTAFFHCVMKHPEN-SQASWYKDG----VLLQEVQDLVRRFYMGPDGSLSIDPTMM----- 216
                ....|.|::.:.:: |...|:||.    .||...:...|         |.||..::     
 Worm   452 VPTESNVSFECLLSNADSYSSVEWFKDAKPIVPLLLPAEKRKR---------LKIDHNVLHLKFA 507

  Fly   217 --SDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPP-----EVFLPYGQPAVLDCHFRANPP 274
              :|.|.|:|...|..|. .::.|.|.::..|.|.  ||     :||..:|....:.|.|.|:|.
 Worm   508 DETDSGVYQCVASNDVGS-SSSSALLTVKDSAPVF--PPNAMSRKVFAAFGSTVSIPCIFEASPR 569

  Fly   275 LKNLRWEKDGLLFDSYNVP--GVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIV 337
            ... :|...|    ...:|  |......|.:...||....||.:.||.:|.|| ...:.|..::|
 Worm   570 FHG-KWADAG----GSKLPQKGRIRDEEGVISIEKVLHEDAGLFFCTAHNKLG-KAHAQVQLIVV 628

  Fly   338 LRPPIFSVTPKAIYIQK----LGEAAELPC-------EAI------DRDGNNRPSI---IWGRKD 382
            .:|.|     |..::.:    :....||.|       ||:      ||.....||:   :..:|.
 Worm   629 NKPSI-----KTNFLDEETVNMSCEVELTCENSAECPEALFEWKINDRPAKEYPSLKSKVHEKKS 688

  Fly   383 GQPLPADRFSLSGGNLTITGLVEGDR--GIYECSATNEAATITAEAELMIENIAPRAPYNLTANS 445
            |.   ..|......:|.:...:.|.|  |.:.||     :.....:|.:.:...| :|..||...
 Worm   689 GH---KGRHLKQKVDLEVPKSLAGSRQIGRFACS-----SLYGGSSEFVTKPQLP-SPIALTVEQ 744

  Fly   446 TE------TCITIRWQ-PGYLR------PNLE-YTVWYRLMEAPEWRTLR---VLDKKVMEATVQ 493
            .:      ....:||: |...|      |.:| |.|..|..:..:||...   |.:.:....||:
 Worm   745 MDEDGKKKKMFRLRWRLPPQHRDTRDHSPKVEGYLVELRTRKNRKWRAAERQLVGNMEKDSITVE 809

  Fly   494 HLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAP-- 556
            :|.|..||:|.|.|.:....|.       .::||     |:          ..|||    |||  
 Worm   810 NLLPNTEYQFRVRSVESAAIGE-------PSIPS-----DW----------VKTAP----GAPSE 848

  Fly   557 ------WNLTAISNQQGWLLHWEHPVQ-GLE----GLRLYAVRWWK-------EPEHFLIGHAET 603
                  |...   :.|..|:.|: |:: |.|    .|| |.|.|.:       ..:..|....:.
 Worm   849 TIDNLKWRSL---DSQTLLVEWQ-PIEIGQESSGDNLR-YRVSWSEATVGKNATDDMKLSNQDDD 908

  Fly   604 FDNYYQLRHLKED---TLFKVQ--------VLA-----------VGTETQQSVPSH 637
            |:|     ||..|   .:.|:.        |||           |||:|...:.||
 Worm   909 FEN-----HLDSDQPQAILKLNTTEGCRMVVLAVRPVNDQGNGSVGTDTIAFLNSH 959

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 19/86 (22%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 25/109 (23%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 1/3 (33%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 21/81 (26%)
Ig 341..428 CDD:472250 20/108 (19%)
Ig strand B 359..363 CDD:409353 2/3 (67%)
Ig strand C 375..380 CDD:409353 1/7 (14%)
Ig strand E 396..400 CDD:409353 1/3 (33%)
Ig strand F 410..415 CDD:409353 1/4 (25%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 26/105 (25%)
FN3 554..636 CDD:238020 29/123 (24%)
rig-6NP_001022014.1 Ig 167..231 CDD:409353
Ig strand C 178..182 CDD:409353
Ig strand E 203..207 CDD:409353
Ig strand F 217..222 CDD:409353
Ig 258..335 CDD:472250
Ig strand B 259..263 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 299..303 CDD:409353
Ig strand F 313..318 CDD:409353
Ig strand G 329..332 CDD:409353
Ig 365..438 CDD:472250 20/108 (19%)
Ig strand B 368..372 CDD:409394 0/3 (0%)
Ig strand C 381..385 CDD:409394 0/4 (0%)
Ig strand E 403..407 CDD:409394 1/4 (25%)
Ig strand F 417..422 CDD:409394 2/4 (50%)
Ig strand G 430..433 CDD:409394 0/2 (0%)
Ig 441..534 CDD:472250 23/105 (22%)
Ig strand B 458..462 CDD:409353 1/3 (33%)
Ig strand C 472..476 CDD:409353 0/3 (0%)
Ig strand E 501..504 CDD:409353 0/2 (0%)
Ig strand F 514..519 CDD:409353 2/4 (50%)
Ig strand G 527..530 CDD:409353 0/2 (0%)
IG_like 555..627 CDD:214653 20/77 (26%)
Ig strand B 558..562 CDD:409353 0/3 (0%)
Ig strand C 571..575 CDD:409353 0/4 (0%)
Ig strand E 593..597 CDD:409353 1/3 (33%)
Ig strand F 607..612 CDD:409353 1/4 (25%)
Ig strand G 620..623 CDD:409353 0/2 (0%)
FN3 737..839 CDD:238020 28/123 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.