DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Fcer1a

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_034314.2 Gene:Fcer1a / 14125 MGIID:95494 Length:250 Species:Mus musculus


Alignment Length:182 Identity:37/182 - (20%)
Similarity:63/182 - (34%) Gaps:43/182 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SLIRIPPVNQTIREGQTAFFHCV-MKHPE-NSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDP 213
            |::.:.|....|..|:.....|. ..|.: ||...|..:|. :.||.          ...|.|..
Mouse    28 SVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGT-VSEVN----------SSHLVIVS 81

  Fly   214 TMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNL 278
            ..:.|.|:|.|:   ..|..::...:||:.....::....::.|.:|. ..:.||          
Mouse    82 ATVQDSGKYICQ---KQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGS-FDIRCH---------- 132

  Fly   279 RWEKDGLLFDSYNVPGVFYKMNGSLF---------FAKVDENHAGSYTCTPY 321
            .|:       ::||..|.|..|...|         ..:...|.:|:|.|..|
Mouse   133 GWK-------NWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 19/90 (21%)
Ig 157..242 CDD:299845 19/86 (22%)
Ig_2 252..337 CDD:290606 16/79 (20%)
IG_like 260..327 CDD:214653 15/71 (21%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Fcer1aNP_034314.2 Ig 28..107 CDD:299845 20/92 (22%)
IG_like 34..93 CDD:214653 16/69 (23%)
Ig 111..192 CDD:299845 16/85 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.