DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Cntn1

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_031753.1 Gene:Cntn1 / 12805 MGIID:105980 Length:1020 Species:Mus musculus


Alignment Length:897 Identity:166/897 - (18%)
Similarity:271/897 - (30%) Gaps:343/897 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAIILLMNISCTSAARD---HRR--------------------------QTNLEAKVGSHVVFNC 55
            |.:..|:.||.||...|   |||                          :.:||.||.    .||
Mouse     5 LLVSHLLLISLTSCLGDFTWHRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGKVS----LNC 65

  Fly    56 YIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRL-----HLVENHPEFGRASVNLTAI 115
            ...   .:|.| :..|..:|..:           :|.|.|.     :||.|:|:           
Mouse    66 RAR---ASPFP-VYKWRMNNGDV-----------DLTNDRYSMVGGNLVINNPD----------- 104

  Fly   116 RESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQ---TIREGQTAFFHCVMKH- 176
            ::.|.|.|:|..|  |....||:.    ...:..|.|...||..:   .::||:.....|...: 
Mouse   105 KQKDAGVYYCLAS--NNYGMVRST----EATLSFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYH 163

  Fly   177 -PENSQASWYKDGVLLQEVQDLV----RRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTA 236
             |::....|     ||.|....:    |||....:|:|.|.....||.|.|.|.|.:........
Mouse   164 FPDDLSYRW-----LLNEFPVFITMDKRRFVSQTNGNLYIANVESSDRGNYSCFVSSPSITKSVF 223

  Fly   237 KAFLNI---------QYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEK---------- 282
            ..|:.:         .|.|.::....:::...||...|:| |....|:.::||.|          
Mouse   224 SKFIPLIPIPERTTKPYPADIVVQFKDIYTMMGQNVTLEC-FALGNPVPDIRWRKVLEPMPSTAE 287

  Fly   283 ---DGLLFDSYN----------------------------------------------------- 291
               .|.:...:|                                                     
Mouse   288 ISTSGAVLKIFNIQLEDEGLYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPC 352

  Fly   292 ------VPGVFYKMN------GSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFS 344
                  :|.:.:..|      |.|....|...:||.|.|...|..|:...:..:.::.| .|.|.
Mouse   353 IATGKPIPTIRWLKNGYSYHKGELRLYDVTFENAGMYQCIAENAYGSIYANAELKILAL-APTFE 416

  Fly   345 VTP--KAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFSL-SGGNLTITGLVEG 406
            :.|  |.|...|.|... :.|:.   ....:|...|.:.....:.:.|..: ..|:|.|..:...
Mouse   417 MNPMKKKILAAKGGRVI-IECKP---KAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRN 477

  Fly   407 DRGIYECSATNEAATITAEAELMIEN-----IAP-RAPYNLTANSTETC---------ITIRWQ- 455
            |.|||.|.|.|......:...|:|.|     :|| .|...:..|:|..|         :|..|. 
Mouse   478 DGGIYTCFAENNRGKANSTGTLVITNPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSF 542

  Fly   456 ----------------------------------------------------------------- 455
                                                                             
Mouse   543 NGYVIDFNKEITHIHYQRNFMLDANGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPG 607

  Fly   456 -PGYLR---------------------PNLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQ----- 493
             ||.||                     |..:||:..:.:.:.:|:..:. |..::|..::     
Mouse   608 PPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKT-DPPIIEGNMESAKAV 671

  Fly   494 HLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPS-PIRADDFDAQQLQHDLGQVTAPAGGLGAPW 557
            .|.|..||||.|::.:..|.|.       .::|| .|:.|.........|:|      ||.|...
Mouse   672 DLIPWMEYEFRVVATNTLGTGE-------PSIPSNRIKTDGAAPNVAPSDVG------GGGGTNR 723

  Fly   558 NLTA----------ISNQQGWLLHWEHPVQGLEGLRLYAVRWWKEPEHFLIGHAETFDNYYQLRH 612
            .||.          ..|..|:::.:: |..|.|         ||:   ..:.:.:|....::...
Mouse   724 ELTITWAPLSREYHYGNNFGYIVAFK-PFDGEE---------WKK---VTVTNPDTGRYVHKDET 775

  Fly   613 LKEDTLFKVQVLAVGTE------------TQQSVPSHELLIDVPSQRKVRAL 652
            :...|.|:|:|.|...:            :.|..||     :.|::..|:.|
Mouse   776 MTPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPS-----EAPTEVGVKVL 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 21/90 (23%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 23/97 (24%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 20/152 (13%)
Ig 341..428 CDD:472250 21/89 (24%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 1/4 (25%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 3/4 (75%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 26/191 (14%)
FN3 554..636 CDD:238020 17/103 (17%)
Cntn1NP_031753.1 IgI_1_Contactin-1 40..134 CDD:409436 25/129 (19%)
Ig strand A 42..46 CDD:409436 0/3 (0%)
Ig strand A' 49..54 CDD:409436 0/4 (0%)
Ig strand B 60..68 CDD:409436 4/11 (36%)
Ig strand C 73..79 CDD:409436 2/6 (33%)
Ig strand C' 81..84 CDD:409436 1/2 (50%)
Ig strand D 90..94 CDD:409436 1/3 (33%)
Ig strand E 96..102 CDD:409436 2/5 (40%)
Ig strand F 109..118 CDD:409436 4/10 (40%)
Ig strand G 121..134 CDD:409436 2/16 (13%)
Ig2_Contactin-2-like 142..230 CDD:409392 21/92 (23%)
Ig strand A 144..149 CDD:409392 0/4 (0%)
Ig strand B 153..159 CDD:409392 0/5 (0%)
Ig strand C 168..174 CDD:409392 1/10 (10%)
Ig strand C' 179..181 CDD:409392 0/1 (0%)
Ig strand D 186..191 CDD:409392 3/4 (75%)
Ig strand E 194..198 CDD:409392 2/3 (67%)
Ig strand F 208..216 CDD:409392 3/7 (43%)
Ig strand G 218..230 CDD:409392 1/11 (9%)
IgI_3_Contactin-1 241..328 CDD:143259 12/87 (14%)
Ig strand A 241..246 CDD:143259 1/4 (25%)
Ig strand A' 249..254 CDD:143259 0/4 (0%)
Ig strand B 257..266 CDD:143259 4/9 (44%)
Ig strand C 272..276 CDD:143259 1/3 (33%)
Ig strand C' 279..281 CDD:143259 0/1 (0%)
Ig strand D 289..292 CDD:143259 0/2 (0%)
Ig strand E 293..298 CDD:143259 0/4 (0%)
Ig strand F 306..314 CDD:143259 0/7 (0%)
Ig strand G 317..328 CDD:143259 0/10 (0%)
Ig 332..408 CDD:472250 11/75 (15%)
Ig strand B 348..352 CDD:143205 0/3 (0%)
Ig strand C 361..365 CDD:143205 0/3 (0%)
Ig strand E 374..378 CDD:143205 2/3 (67%)
Ig strand F 388..393 CDD:143205 2/4 (50%)
Ig strand G 401..404 CDD:143205 0/2 (0%)
Ig5_Contactin-1 413..501 CDD:409438 22/91 (24%)
Ig strand A 413..418 CDD:409438 2/4 (50%)
Ig strand A' 421..426 CDD:409438 2/4 (50%)
Ig strand B 430..437 CDD:409438 1/7 (14%)
Ig strand C 445..449 CDD:409438 0/3 (0%)
Ig strand D 463..466 CDD:409438 0/2 (0%)
Ig strand E 467..472 CDD:409438 2/4 (50%)
Ig strand F 480..488 CDD:409438 5/7 (71%)
Ig strand G 494..501 CDD:409438 1/6 (17%)
Ig6_Contactin 503..603 CDD:409359 9/99 (9%)
Ig strand A 503..509 CDD:409359 1/5 (20%)
Ig strand A' 512..517 CDD:409359 1/4 (25%)
Ig strand B 520..528 CDD:409359 3/7 (43%)
Ig strand C 537..541 CDD:409359 1/3 (33%)
Ig strand D 564..567 CDD:409359 0/2 (0%)
Ig strand E 568..572 CDD:409359 0/3 (0%)
Ig strand F 581..588 CDD:409359 0/6 (0%)
Ig strand G 595..599 CDD:409359 0/3 (0%)
FN3 612..699 CDD:238020 18/94 (19%)
FN3 650..>947 CDD:442628 42/205 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 695..719 7/29 (24%)
fn3 813..895 CDD:394996 3/10 (30%)
FN3 907..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.