DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and FCRLB

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001002901.1 Gene:FCRLB / 127943 HGNCID:26431 Length:426 Species:Homo sapiens


Alignment Length:322 Identity:77/322 - (23%)
Similarity:118/322 - (36%) Gaps:97/322 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMG----PDGSLSID 212
            ::.:.|...||.:|:.....|...||            ||.|:|.:...:|:|    |....||:
Human    24 ILSLHPPWTTIFKGERVTLKCDGYHP------------LLLELQPISTLWYLGHLLLPSHKKSIE 76

  Fly   213 PTMMSDLGEYECKVRN---SDG-ELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANP 273
               :...|.|.|:.|.   ||. .|..:..:|.:|    |.|||  ||  .|:|.||.|....:.
Human    77 ---VQTPGVYRCQTRGAPVSDPIHLSVSNDWLILQ----VPYAP--VF--EGEPLVLRCRGWYDK 130

  Fly   274 PLKNLRWEKDGLLFDSYNVPGVFY---KMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISV 335
            .:..|.:..||        ..|.|   ..|.::..|:..:  :|.|.|:     ||      :.:
Human   131 VVYKLHYYHDG--------QAVRYFHSSANYTVLQARASD--SGRYQCS-----GT------MRI 174

  Fly   336 IVLRPPIFSVTPKAIYIQKLGEAAEL----PCEAIDRDGNNRPSIIWG-----------RKDGQP 385
            .|...|:|| ...|:.:|:|..|..|    |.||       |.:.:.|           :|...|
Human   175 PVESAPMFS-AKVAVTVQELFRAPVLRVMGPREA-------RGAALGGVVLRCDTRLHPQKRDTP 231

  Fly   386 LPADRFSLS--------GGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPY 439
            |....:..|        |...|:......:...|.|    ||||.|       .::..|:|:
Human   232 LQFAFYKYSRAVRRFDWGAEYTVPEPEVEELESYWC----EAATAT-------RSVRKRSPW 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 24/96 (25%)
Ig 157..242 CDD:299845 24/92 (26%)
Ig_2 252..337 CDD:290606 20/87 (23%)
IG_like 260..327 CDD:214653 16/69 (23%)
I-set 341..428 CDD:254352 26/109 (24%)
IGc2 356..419 CDD:197706 15/85 (18%)
FN3 435..524 CDD:238020 2/5 (40%)
FN3 554..636 CDD:238020
FCRLBNP_001002901.1 Ig1_FcgammaR_like 23..100 CDD:143229 23/90 (26%)
Ig2_FcgammaR_like 104..186 CDD:143230 29/111 (26%)
IG_like 114..190 CDD:214653 24/99 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.