DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Opcml

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:337 Identity:76/337 - (22%)
Similarity:118/337 - (35%) Gaps:82/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNG--------RLHL 98
            |:..:.|......|.||               |......|..:.|.   |:.|        |:.:
  Rat    44 NVTVRQGESATLRCTID---------------DRVTRVAWLNRSTI---LYAGNDKWSIDPRVII 90

  Fly    99 VENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPP------ 157
            :.|.|.  :.|:.:..:...|:|.|.|.|...|...:.|     .||.||      :||      
  Rat    91 LVNTPT--QYSIMIQNVDVYDEGPYTCSVQTDNHPKTSR-----VHLIVQ------VPPQIMNIS 142

  Fly   158 VNQTIREGQTAFFHCV-MKHPENSQASW----YKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMS 217
            .:.|:.||.:....|: :..||.: .:|    .|:|           :.::..|..|.|......
  Rat   143 SDITVNEGSSVTLLCLAIGRPEPT-VTWRHLSVKEG-----------QGFVSEDEYLEISDIKRD 195

  Fly   218 DLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVF------LPYGQPAVLDCHFRANPPLK 276
            ..|||||...|........|..:.:.|       ||.:.      :..||..:|.|...| .|:.
  Rat   196 QSGEYECSALNDVAAPDVRKVKITVNY-------PPYISKAKNTGVSVGQKGILSCEASA-VPMA 252

  Fly   277 NLRWEKDGLLFDSYNVPGVFYKMNG---SLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVL 338
            ..:|.|:.... :..:.||..:..|   :|.|..|.|...|:|||...|.||....|  |::..:
  Rat   253 EFQWFKEDTRL-ATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNAS--ITLYEI 314

  Fly   339 RPPIFSVTPKAI 350
            .|......|.|:
  Rat   315 SPSSAVAGPGAV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 18/93 (19%)
Ig 43..131 CDD:299845 18/95 (19%)
I-set 153..242 CDD:254352 21/99 (21%)
Ig 157..242 CDD:299845 20/95 (21%)
Ig_2 252..337 CDD:290606 26/93 (28%)
IG_like 260..327 CDD:214653 22/69 (32%)
I-set 341..428 CDD:254352 2/10 (20%)
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 23/112 (21%)
Ig strand A' 44..49 CDD:409353 1/4 (25%)
Ig strand B 51..59 CDD:409353 1/7 (14%)
CDR1 59..63 CDD:409353 3/18 (17%)
FR2 64..70 CDD:409353 1/5 (20%)
Ig strand C 64..70 CDD:409353 1/5 (20%)
CDR2 71..83 CDD:409353 3/14 (21%)
Ig strand C' 72..76 CDD:409353 1/6 (17%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/35 (23%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 3/13 (23%)
FR4 125..132 CDD:409353 3/11 (27%)
Ig_3 135..206 CDD:404760 19/82 (23%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 1/8 (13%)
Ig strand C 165..170 CDD:409353 0/5 (0%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 5/7 (71%)
Ig_3 223..300 CDD:404760 21/78 (27%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.