Sequence 1: | NP_608822.1 | Gene: | bdl / 33635 | FlyBaseID: | FBgn0028482 | Length: | 719 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017450901.1 | Gene: | Opcml / 116597 | RGDID: | 620635 | Length: | 354 | Species: | Rattus norvegicus |
Alignment Length: | 337 | Identity: | 76/337 - (22%) |
---|---|---|---|
Similarity: | 118/337 - (35%) | Gaps: | 82/337 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 NLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNG--------RLHL 98
Fly 99 VENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPP------ 157
Fly 158 VNQTIREGQTAFFHCV-MKHPENSQASW----YKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMS 217
Fly 218 DLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVF------LPYGQPAVLDCHFRANPPLK 276
Fly 277 NLRWEKDGLLFDSYNVPGVFYKMNG---SLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVL 338
Fly 339 RPPIFSVTPKAI 350 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bdl | NP_608822.1 | IG_like | 42..128 | CDD:214653 | 18/93 (19%) |
Ig | 43..131 | CDD:299845 | 18/95 (19%) | ||
I-set | 153..242 | CDD:254352 | 21/99 (21%) | ||
Ig | 157..242 | CDD:299845 | 20/95 (21%) | ||
Ig_2 | 252..337 | CDD:290606 | 26/93 (28%) | ||
IG_like | 260..327 | CDD:214653 | 22/69 (32%) | ||
I-set | 341..428 | CDD:254352 | 2/10 (20%) | ||
IGc2 | 356..419 | CDD:197706 | |||
FN3 | 435..524 | CDD:238020 | |||
FN3 | 554..636 | CDD:238020 | |||
Opcml | XP_017450901.1 | Ig | 44..132 | CDD:416386 | 23/112 (21%) |
Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 51..59 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 59..63 | CDD:409353 | 3/18 (17%) | ||
FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 71..83 | CDD:409353 | 3/14 (21%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/6 (17%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 8/35 (23%) | ||
Ig strand D | 87..94 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 3/13 (23%) | ||
FR4 | 125..132 | CDD:409353 | 3/11 (27%) | ||
Ig_3 | 135..206 | CDD:404760 | 19/82 (23%) | ||
Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 151..160 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 165..170 | CDD:409353 | 0/5 (0%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 5/7 (71%) | ||
Ig_3 | 223..300 | CDD:404760 | 21/78 (27%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 293..298 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 306..309 | CDD:409353 | 1/4 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |