DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dscaml1

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_004916122.1 Gene:dscaml1 / 100491996 XenbaseID:XB-GENE-922538 Length:2043 Species:Xenopus tropicalis


Alignment Length:748 Identity:179/748 - (23%)
Similarity:261/748 - (34%) Gaps:221/748 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 APIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASV---NLTAIRESDQGWYH 124
            || |..:.||.|::.|     |..|.        |....:.....::|   |:::.:..|.|.|.
 Frog   433 AP-PPTITWTLDDEPI-----QRDSG--------HRSNQYTTADGSTVSYMNVSSPQILDGGVYR 483

  Fly   125 CQVSFPNRSPSVRNN-GTAYHLA---VQGGSLIRIPPVNQTIREGQTAFFHC-VMKHPENSQASW 184
            |         :.||: |:|.:.|   |:|...|| |..|.|...|:.:|.|| |:.:|... .||
 Frog   484 C---------AARNSVGSAEYQARINVRGPPSIR-PMKNLTAVAGRDSFIHCRVIGYPYYF-ISW 537

  Fly   185 YKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDL------GEYECKVRNSDGELQTAKAFLNIQ 243
            |||.:||.:    ..|..:..:|:|     |:||:      |||.|.|        ..:..|:|.
 Frog   538 YKDSLLLPD----NHRQVVFENGTL-----MLSDVQKGMDEGEYLCSV--------LIQPQLSIS 585

  Fly   244 YKAKVIYAPPEVFLPY-------GQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMN- 300
            ....|....|.:..|:       ||...:.|...:......:.|.|||.:..|.:  |:..:.. 
 Frog   586 QSVHVTVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIVSGS--GITIETKE 648

  Fly   301 --GSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPK---AIYIQKLGEAAE 360
              .||..:.|...|.|:|||...||..|  .|....:||..||.|.|.|.   .||    |:|..
 Frog   649 FMSSLQISSVSLKHNGNYTCIASNDAAT--VSRERQLIVRVPPRFVVQPNNQDGIY----GKAGV 707

  Fly   361 LPCEAIDRDGNNRPSIIWGRKDGQ---------PLPADRFSLSGGNLTITGLVEGDRGIYECSAT 416
            |.|..   ||...|.::|....|.         ||......|...:|.|..::|.|.|.|.|.|:
 Frog   708 LNCSV---DGYPPPKVVWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQAS 769

  Fly   417 NEAAT-------ITAEAELMIEN-----IAPRAP---YNLTANSTETCITIRWQPG--YLRP--N 462
            |...|       :|.:...||.:     ||.:..   .|.||.. |..|.|||:.|  .:.|  |
 Frog   770 NGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGQTKGLNCTARG-ERPIIIRWEKGDTVIDPDRN 833

  Fly   463 LEYTVWYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPS 527
            |.|.:          .|....|:.:...|::..:.|....|...:.:.||:.....|...|..|.
 Frog   834 LRYLI----------ATKDSGDEVISTLTLKPAERGDSVFFSCHAINSYGEDRGLIQLTVQEPPD 888

  Fly   528 P-------IRADDFDAQQLQHDLGQVTAPAGGL-----GAPW-------NLTAISNQQGWLLHWE 573
            |       ::|...:.:..|...|.....|..:     ...|       |::.|.||..      
 Frog   889 PPELEVREVKARSMNLRWTQRFDGNSIITAFDIEYKNKSDSWEFKQSTRNISPIINQAN------ 947

  Fly   574 HPVQGLEGLRLYAVRW--------------------------------------------WKEPE 594
              :..|....:|::|.                                            ||.|.
 Frog   948 --IVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPLTSQSIQVTWKAPR 1010

  Fly   595 H---------FLIGHAE----------------TFD-NYYQLRHLKEDTLFKVQVLA---VGTET 630
            .         :.||:.|                |.| ..|.|.::|:...:.|.|.|   .||..
 Frog  1011 KELQNGVIRGYQIGYRENGPGSNGQYSIVEMKATGDAEVYTLDNMKKFAQYGVVVQAFNRAGTGP 1075

  Fly   631 QQSVPSHELLIDVPSQ--RKVRALIIGSSVGVI 661
            ..:..:...|.||||:  ..||.|.|.|.|.||
 Frog  1076 SSTEINATTLEDVPSKPPENVRVLSITSDVAVI 1108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 16/67 (24%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 1/6 (17%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 30/95 (32%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 1/3 (33%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 3/4 (75%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 20/84 (24%)
Ig 341..428 CDD:472250 29/105 (28%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 1/4 (25%)
Ig strand E 396..400 CDD:409353 1/3 (33%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 1/2 (50%)
FN3 435..524 CDD:238020 21/95 (22%)
FN3 554..636 CDD:238020 24/161 (15%)
dscaml1XP_004916122.1 Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409547
Ig strand C 55..59 CDD:409547
Ig strand E 79..83 CDD:409547
Ig strand F 99..104 CDD:409547
Ig strand G 112..116 CDD:409547
Ig 129..217 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 194..199 CDD:409353
Ig strand G 210..213 CDD:409353
I-set 232..310 CDD:400151
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand E 276..280 CDD:409353
Ig strand F 290..295 CDD:409353
Ig strand G 303..306 CDD:409353
Ig 313..395 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250 21/90 (23%)
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353 0/3 (0%)
Ig strand E 467..471 CDD:409353 0/3 (0%)
Ig strand F 481..486 CDD:409353 2/13 (15%)
Ig strand G 494..497 CDD:409353 0/2 (0%)
IgI_5_Dscam 504..592 CDD:409550 32/106 (30%)
Ig strand A 505..507 CDD:409550 0/1 (0%)
Ig strand A' 512..516 CDD:409550 2/3 (67%)
Ig strand B 519..526 CDD:409550 2/6 (33%)
Ig strand C 533..539 CDD:409550 2/6 (33%)
Ig strand C' 540..542 CDD:409550 1/1 (100%)
Ig strand D 549..553 CDD:409550 1/3 (33%)
Ig strand E 556..562 CDD:409550 3/10 (30%)
Ig strand F 570..578 CDD:409550 5/15 (33%)
Ig strand G 582..592 CDD:409550 3/9 (33%)
Ig 595..685 CDD:472250 23/93 (25%)
Ig strand B 612..616 CDD:409353 0/3 (0%)
Ig strand C 626..630 CDD:409353 0/3 (0%)
Ig strand E 651..655 CDD:409353 2/3 (67%)
Ig strand F 665..670 CDD:409353 3/4 (75%)
Ig strand G 678..681 CDD:409353 1/2 (50%)
Ig_DSCAM 688..784 CDD:409397 29/102 (28%)
putative Ig strand A 688..692 CDD:409397 2/3 (67%)
putative Ig strand A' 697..701 CDD:409397 0/3 (0%)
putative Ig strand B 703..713 CDD:409397 4/12 (33%)
putative Ig strand C 719..725 CDD:409397 1/5 (20%)
putative Ig strand C' 732..735 CDD:409397 0/2 (0%)
putative Ig strand D 744..747 CDD:409397 0/2 (0%)
putative Ig strand E 749..755 CDD:409397 2/5 (40%)
putative Ig strand F 762..770 CDD:409397 4/7 (57%)
putative Ig strand G 775..784 CDD:409397 0/8 (0%)
Ig_DSCAM 785..885 CDD:409398 25/110 (23%)
putative Ig strand A 785..788 CDD:409398 0/2 (0%)
putative Ig strand A' 796..800 CDD:409398 1/3 (33%)
putative Ig strand B 803..810 CDD:409398 1/6 (17%)
putative Ig strand C 818..824 CDD:409398 3/5 (60%)
putative Ig strand C' 834..837 CDD:409398 1/2 (50%)
putative Ig strand D 843..847 CDD:409398 1/3 (33%)
putative Ig strand E 849..855 CDD:409398 1/5 (20%)
putative Ig strand F 862..870 CDD:409398 1/7 (14%)
putative Ig strand G 873..883 CDD:409398 2/9 (22%)
FN3 886..980 CDD:238020 14/101 (14%)
FN3 987..1084 CDD:238020 16/96 (17%)
fn3 1092..1178 CDD:394996 8/17 (47%)
FN3 1190..1281 CDD:238020
Ig_3 1290..1366 CDD:464046
FN3 1383..1473 CDD:238020
FN3 1487..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.