DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and ncam2

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:729 Identity:142/729 - (19%)
Similarity:266/729 - (36%) Gaps:171/729 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRA 108
            |.|.|.:....|.:.   .:|.| :|.|..:.:.:          :::.:.|..::.|:      
 Frog   154 EFKRGENAEVLCLVS---SSPAP-MVRWLNNREDV----------TDIDDRRFAMLPNN------ 198

  Fly   109 SVNLTAIRESDQGWYHC--------QVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPP-------- 157
            ::.:..|.:.|:|.|.|        ::.|  |..||               ::.:||        
 Frog   199 NLQIKNISKRDEGIYRCEGRVEVRGEIDF--RDISV---------------IVNVPPEILAQQRS 246

  Fly   158 VNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGS-LSIDPTMMSDLGE 221
            .|.|....:.....|..........:|:::|.|::|.:    ::.:..|.: |::...:.:|.|.
 Frog   247 FNATADRLEDITLFCRATGSPKPYITWHRNGKLVEENE----KYDLREDNTELTVKNIISTDSGL 307

  Fly   222 YECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEK--DG 284
            |.|:..|..| ....::||.:..:..::....|..:.:|. ..|.|..... |:..:.|::  ||
 Frog   308 YVCRATNKAG-FTEKQSFLQVFVQPHIVQLQNETTIEHGH-VTLTCEAEGE-PIPEITWKRSSDG 369

  Fly   285 LLF------DSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIF 343
            ::|      ....:....:....||....|..:.||.|.|...:.:|....|..:::..  .|.|
 Frog   370 MIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDAGRYDCEAASRIGGHQKSMYLNIEY--APKF 432

  Fly   344 SVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRF----SLSGGN---LTIT 401
             ::.:.||.........:.|:..    :|.||.|:..:|...|||...    :...|.   |.||
 Frog   433 -ISNQTIYYSWENNPINISCDVT----SNPPSSIYWSRDKLLLPARNITNIKTYRDGKRILLEIT 492

  Fly   402 GLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCITIRWQPGYLR------ 460
            .|.:.|.|.|.|:|.|...:...|..|.:.:: |.:||.|.        .|.....|.:      
 Frog   493 PLSDNDFGRYNCTAINSIGSRIQEYILTLADV-PSSPYGLR--------VIELSQTYAKVFFNKP 548

  Fly   461 ------PNLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQ 519
                  |...|.:.::.:.:..|:.:|....:.: ..:.:|.....||..|.:.:..|.|.:||.
 Frog   549 DSHGGVPIHHYQMDFKEVSSEIWKVVRSHGTQTI-IVLGNLDANTTYEVKVAAVNGKGKGEYSKT 612

  Fly   520 FRFQTL----PSPIRADDFDAQQLQHDLGQVTAPAGGLGAPWNLTAISNQQGWLLHWEHPVQGLE 580
            ..||||    |||....           ||   |.||.....::|...:....:|:         
 Frog   613 EIFQTLPVREPSPPSIH-----------GQ---PGGGKSFKLSITKQDDGGAPILN--------- 654

  Fly   581 GLRLYAVRW--------WKEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVLAVGT--ETQQSV- 634
                |.|::        |.|.:  .:|:.:    |..|.||:.:..::|.::|...  .::.:| 
 Frog   655 ----YVVKYRSKDKEDQWLEKK--FLGNKD----YIILDHLQWNVGYEVHIIATNRLGHSEPTVF 709

  Fly   635 -----PSHELLIDVPSQRKVRALIIGSSVGVIFLLCAL----CAFLYVKRSC------LRHLFAK 684
                 |...::.|..........:||.:|..:.|:..:    |.|:   |.|      .|.:..|
 Frog   710 EFLMPPKPNIIADTLFSGLGVGAVIGLAVAALLLVLVVTDVSCFFI---RQCGLLMCITRRICGK 771

  Fly   685 DSSASEDEDTAESG 698
            .|.:|......|.|
 Frog   772 KSGSSGKSKELEEG 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 15/91 (16%)
Ig strand C 69..72 CDD:409512 1/2 (50%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/12 (17%)
Ig 153..242 CDD:472250 19/97 (20%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 1/4 (25%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 16/82 (20%)
Ig 341..428 CDD:472250 25/93 (27%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 2/6 (33%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 19/100 (19%)
FN3 554..636 CDD:238020 14/97 (14%)
ncam2XP_012811963.1 Ig 50..142 CDD:472250
Ig strand B 67..71 CDD:409452
Ig strand C 79..83 CDD:409452
Ig strand E 105..109 CDD:409452
Ig strand F 119..124 CDD:409452
Ig strand G 133..136 CDD:409452
IG_like 150..234 CDD:214653 19/116 (16%)
Ig strand B 161..165 CDD:409353 0/3 (0%)
Ig strand C 174..178 CDD:409353 1/3 (33%)
Ig strand E 198..202 CDD:409353 0/9 (0%)
Ig strand F 212..217 CDD:409353 2/4 (50%)
Ig 238..327 CDD:472250 18/93 (19%)
Ig strand B 257..261 CDD:409301 0/3 (0%)
Ig strand C 270..274 CDD:409301 0/3 (0%)
Ig strand E 293..297 CDD:409301 1/3 (33%)
Ig strand F 307..312 CDD:409301 2/4 (50%)
Ig strand G 320..323 CDD:409301 0/2 (0%)
Ig 329..426 CDD:472250 18/98 (18%)
Ig strand B 347..351 CDD:143278 1/3 (33%)
Ig strand C 360..364 CDD:143278 0/3 (0%)
Ig strand E 392..396 CDD:143278 2/3 (67%)
Ig strand F 406..411 CDD:143278 2/4 (50%)
Ig strand G 419..422 CDD:143278 0/2 (0%)
Ig_3 430..508 CDD:464046 23/82 (28%)
FN3 525..617 CDD:238020 19/100 (19%)
fn3 623..707 CDD:394996 21/116 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.