DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and lrit3b

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:480 Identity:93/480 - (19%)
Similarity:140/480 - (29%) Gaps:200/480 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRTFRQSGSALLALLAIILLMNISCTSAARDHRRQ-TNLEAKVGSHVVFNCYIDFPFDAPIPYLV 69
            ||.||.:.||:..||.:.|..|    |.:..|.|. |||.:.....:..|....||::.      
Zfish   101 SRIFRGAFSAMPELLYLWLTYN----SISVLHPRSFTNLSSLHELRLDGNLLSTFPWEG------ 155

  Fly    70 HWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSF----P 130
              .:|..::        .|..|.|.||           |.:.|.|:|      |...|::    .
Zfish   156 --LRDMPRL--------RTLGLHNNRL-----------ARIPLLAVR------YLRNVTYLDLSS 193

  Fly   131 NRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQ 195
            ||..::.|:.||..|         ....|||    |.:|...:..:|      |..| ..|..:.
Zfish   194 NRLSTLANDLTALWL---------FSDSNQT----QRSFVLGLQDNP------WVCD-CRLSTLL 238

  Fly   196 DLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYG 260
            |:.|    ||:.||                                                   
Zfish   239 DISR----GPESSL--------------------------------------------------- 248

  Fly   261 QPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLG 325
              .:||.....:.||            |...||           |..|:.:.     |.      
Zfish   249 --VLLDRFLTCSEPL------------DLAGVP-----------FQSVELSR-----CR------ 277

  Fly   326 TDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRK--------- 381
                         ||  :.||........||....|.|||   .|:..|:::|.:.         
Zfish   278 -------------RP--YVVTSATKITALLGSTVLLRCEA---TGHPTPALMWIKSAKRNLYNQG 324

  Fly   382 ---------DGQPLP---------ADRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAEL 428
                     |.:..|         :.|..:....:::.|:...|.|.|.|.|.|.|.  .:||.:
Zfish   325 CCKQTQSSLDTERFPKKLFGYVQESPRVGVRWSVVSLNGISYSDAGEYRCRAQNMAG--ISEAVV 387

  Fly   429 MIENIAPRAPYNLTANSTETCITIR 453
            .:..:...|.|....||.:...|.:
Zfish   388 SLNVVGVMAEYTDFKNSDQQQTTTK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 16/85 (19%)
Ig 43..131 CDD:299845 16/91 (18%)
I-set 153..242 CDD:254352 15/88 (17%)
Ig 157..242 CDD:299845 15/84 (18%)
Ig_2 252..337 CDD:290606 10/84 (12%)
IG_like 260..327 CDD:214653 10/66 (15%)
I-set 341..428 CDD:254352 24/113 (21%)
IGc2 356..419 CDD:197706 18/89 (20%)
FN3 435..524 CDD:238020 5/19 (26%)
FN3 554..636 CDD:238020
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566 17/79 (22%)
leucine-rich repeat 114..137 CDD:275378 10/26 (38%)
leucine-rich repeat 138..161 CDD:275378 4/30 (13%)
LRR_8 160..214 CDD:290566 17/87 (20%)
LRR_4 160..201 CDD:289563 13/65 (20%)
leucine-rich repeat 162..185 CDD:275378 10/47 (21%)
leucine-rich repeat 186..199 CDD:275378 3/12 (25%)
leucine-rich repeat 215..230 CDD:275378 5/24 (21%)
Ig 278..391 CDD:299845 26/119 (22%)
I-set 279..391 CDD:254352 25/118 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.