DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dscaml1

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_005157551.2 Gene:dscaml1 / 100002762 ZFINID:ZDB-GENE-110601-1 Length:2089 Species:Danio rerio


Alignment Length:740 Identity:172/740 - (23%)
Similarity:266/740 - (35%) Gaps:202/740 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 APIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQV 127
            || |..:.||.|::.:........|...|.:|.   ..:|       ||:|..:..|.|.|.|  
Zfish   434 AP-PPTITWTLDDEPVARDSAHRASQYTLSDGS---TVSH-------VNVTNPQIRDGGVYRC-- 485

  Fly   128 SFPNRSPSVRNN-GTAYHLAVQGGSLIRIPPVNQTIRE-----GQTAFFHC-VMKHPENSQASWY 185
                   :.||: |:|.:   |....:|.||..:.:|.     |:..|.:| |:.:|..| ..||
Zfish   486 -------AARNSAGSAEY---QARINV
RGPPSIRAMRNITAVAGRNTFINCRVIGYPYYS-IKWY 539

  Fly   186 KDGVLLQEVQDLVRRFYMGPDGSLSI-DPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVI 249
            |||:||.:    ..|..:..:|:|.: |.....|.|.|.|.|        ..:..|:|.....|.
Zfish   540 KDGMLLPD----NHRQVVYENGTLKLSDVQKGMDEGAYLCSV--------LIQPQLSISQTVYVT 592

  Fly   250 YAPPEVFLPY-------GQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMN---GSLF 304
            ...|.:..|:       |:...:.|...:......:.|.|||....| ...||..:..   .||.
Zfish   593 VKVPPLIQPFDFPPTSIGKLMYIACVVSSGDMPIRITWRKDGQEIVS-GTAGVTIETKEFMSSLQ 656

  Fly   305 FAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPK---AIYIQKLGEAAELPCEAI 366
            .:||...|.|:|||...||..|  .|....:||..||.|.|.|.   .||    |::..|.|.. 
Zfish   657 ISKVSLKHNGNYTCIASNDAAT--VSSERQLIV
TVPPRFRVQPNNQDGIY----GKSEVLNCSV- 714

  Fly   367 DRDGNNRPSIIWGRKDG-------QPLP-ADRFS-LSGGNLTITGLVEGDRGIYECSATNEAATI 422
              :|...|.::|....|       .|:| ..|.. ||.|:|.|..::|.|||.|.|.|:|...:.
Zfish   715 --EGYPPPKVVWKHAKGIGNPQQYHPVPLTGRIQILSNGSLLIRHVLEEDRGYYLCQASNGVGSD 777

  Fly   423 TAEAELMIENIAPRAPYNLTANSTET-----------C-------ITIRWQPGYLRPNLEYTVWY 469
            .:::.::...|    |..:|::...|           |       |.|||:.|....:.:....|
Zfish   778 ISKSMMLTV
KI----PAMITSHPNTTMAIKGQNKELNCTARGEYPIIIRWERGDTVIDPDRNPRY 838

  Fly   470 RLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSP----IR 530
            .:..:|..::    |:.:....::..:.|....|...:.:.||:|....|...|..|.|    :|
Zfish   839 SITTSPNEKS----DEVISTLKLKPAERGDSVFFSCHAINSYGEGRGLIQLTVQEPPDPPELEVR 899

  Fly   531 -----------ADDFDAQQL--QHDLGQVTAPAGGLGAPWNL------TAISNQQGWLLHWEHPV 576
                       ...||...:  .:|:.....     ..||.|      .:.:|.|..::.. ||.
Zfish   900 EVKDRSMNLRWTQRFDGNSIITSYDIEYKNK-----SDPWELKHATRKISPTNNQANIVEL-HPA 958

  Fly   577 QGLEGLRLYAVR---------------------------------------WWKEPEH------- 595
             .:..:|:|:..                                       .||.|:.       
Zfish   959 -SVYSIRMYSYNKIGRSQASKELTISTEEAPPDGPPMEVILQPMTSQSIRVTWKAPKKELQNGVI 1022

  Fly   596 --FLIGHAE----------------TFDN-YYQLRHLKEDTLFKVQVLA---VGTETQQSVPSHE 638
              :.||:.|                |.|: .|.|.:||:...:.|.|.|   .||....|..:..
Zfish  1023 RGYQIGYRENGPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINAT 1087

  Fly   639 LLIDVPSQ--RKVRALIIGSSVGVI 661
            .|.|||||  :.|||:.:.|...||
Zfish  1088 TLEDVPSQPPQNVRAITVTSDEAVI 1112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 17/64 (27%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 1/3 (33%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 27/95 (28%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 21/84 (25%)
Ig 341..428 CDD:472250 29/98 (30%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 1/4 (25%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 18/106 (17%)
FN3 554..636 CDD:238020 27/155 (17%)
dscaml1XP_005157551.2 Ig 27..122 CDD:472250
Ig strand B 43..47 CDD:409353
Ig strand C 56..60 CDD:409353
Ig strand E 80..84 CDD:409353
Ig strand F 100..105 CDD:409353
Ig strand G 113..117 CDD:409353
I-set 233..311 CDD:400151
Ig strand B 243..247 CDD:409353
Ig strand C 256..260 CDD:409353
Ig strand F 291..296 CDD:409353
Ig 314..396 CDD:472250
Ig strand B 332..336 CDD:409353
Ig strand C 345..349 CDD:409353
Ig strand E 369..373 CDD:409353
Ig strand F 383..388 CDD:409353
Ig 407..502 CDD:472250 22/90 (24%)
Ig strand B 425..429 CDD:409353
Ig strand C 438..442 CDD:409353 0/3 (0%)
Ig strand E 468..472 CDD:409353 2/10 (20%)
Ig strand F 482..487 CDD:409353 2/13 (15%)
Ig strand G 495..498 CDD:409353 0/5 (0%)
Ig 505..593 CDD:472250 28/100 (28%)
Ig strand B 522..526 CDD:409353 1/3 (33%)
Ig strand C 535..539 CDD:409353 1/4 (25%)
Ig strand E 557..561 CDD:409353 2/3 (67%)
Ig strand F 572..577 CDD:409353 2/4 (50%)
Ig strand G 586..589 CDD:409353 0/2 (0%)
Ig 596..687 CDD:472250 24/93 (26%)
Ig strand B 613..617 CDD:409353 0/3 (0%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 653..657 CDD:409353 2/3 (67%)
Ig strand F 667..672 CDD:409353 3/4 (75%)
Ig strand G 680..683 CDD:409353 1/2 (50%)
Ig_DSCAM 690..786 CDD:409397 30/102 (29%)
putative Ig strand A 690..694 CDD:409397 2/3 (67%)
putative Ig strand A' 699..703 CDD:409397 0/3 (0%)
putative Ig strand B 705..715 CDD:409397 3/12 (25%)
putative Ig strand C 721..727 CDD:409397 1/5 (20%)
putative Ig strand C' 734..737 CDD:409397 0/2 (0%)
putative Ig strand D 746..749 CDD:409397 0/2 (0%)
putative Ig strand E 751..757 CDD:409397 3/5 (60%)
putative Ig strand F 764..772 CDD:409397 4/7 (57%)
putative Ig strand G 777..786 CDD:409397 0/8 (0%)
Ig 787..889 CDD:472250 19/109 (17%)
Ig strand B 807..811 CDD:409353 0/3 (0%)
Ig strand C 820..824 CDD:409353 2/3 (67%)
Ig strand E 853..857 CDD:409353 0/3 (0%)
Ig strand F 867..872 CDD:409353 1/4 (25%)
Ig strand G 880..883 CDD:409353 0/2 (0%)
fn3 891..977 CDD:394996 15/92 (16%)
FN3 991..1088 CDD:238020 18/96 (19%)
fn3 1096..1195 CDD:394996 6/17 (35%)
FN3 1207..1298 CDD:238020
Ig 1323..1396 CDD:472250
Ig strand B 1323..1327 CDD:409353
Ig strand C 1336..1340 CDD:409353
Ig strand E 1362..1366 CDD:409353
Ig strand F 1376..1381 CDD:409353
FN3 1417..1490 CDD:238020
FN3 1504..1580 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.