DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT9

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_612373.2 Gene:PRMT9 / 90826 HGNCID:25099 Length:845 Species:Homo sapiens


Alignment Length:355 Identity:95/355 - (26%)
Similarity:155/355 - (43%) Gaps:75/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELAKDDE---KMDGNHT--------------DANQIIKDRRRQEEHYFKLYGRIEIHEW---LLK 48
            ||..|||   ...|.|.              .|.::..|....:|:::::...: :..|   :|.
Human    95 ELFPDDEVICNSMGEHLFRMGFRDEAAGYFHKAVKLNPDFSDAKENFYRVANWL-VERWHFIMLN 158

  Fly    49 DSVRIKAYREAIQHNEFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVE-AATISEFAQQVVQDN 112
            |:.|...|..|||.......|:|||:|.|.|:|||||.|||:..|.|.| :.|:.|.|..||..|
Human   159 DTKRNTIYNAAIQKAVCLGSKSVLDIGAGTGILSMFAKKAGAHSVYACELSKTMYELACDVVAAN 223

  Fly   113 EFGRVIQVIQGKVEDIELPDGI-KKVDIIVCDWMGSCLFSGNMLESLLFA--------RDKWLSA 168
            :....|:::..|..|||:|..| ::|.::|.:.:.:.||...::|||:.|        :.|..||
Human   224 KMEAGIKLLHTKSLDIEIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESA 288

  Fly   169 T----GHIYPDTAQLYLAAIK----GRDQDLGFWHDVHGFDL-------SAIRRRCESKAVVEHV 218
            .    |.:.|.:|.::..|::    .|...:|. .|:.|..|       |......:::..:|..
Human   289 NCEKYGKVIPASAVIFGMAVECAEIRRHHRVGI-KDIAGIHLPTNVKFQSPAYSSVDTEETIEPY 352

  Fly   219 TGDQMMSRV-----CLVKSLDLYTEPRQSAKSRSLFELK-------------VSRNGWVHGLVAY 265
            |.:: ||||     .|.:..::.|     ....:|.|||             |.:.|.:..::.:
Human   353 TTEK-MSRVPGGYLALTECFEIMT-----VDFNNLQELKSLATKKPDKIGIPVIKEGILDAIMVW 411

  Fly   266 FDVGFSKSTQRISFSTSPSAPWTHWNQTVF 295
            |.:   :.....|.|||||.. |.|.|.|:
Human   412 FVL---QLDDEHSLSTSPSEE-TCWEQAVY 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 32/81 (40%)
PRMT9NP_612373.2 TPR 1 25..58
TPR <39..144 CDD:223533 10/48 (21%)
TPR 2 67..100 2/4 (50%)
TPR repeat 68..95 CDD:276809 95/355 (27%)
TPR repeat 100..130 CDD:276809 5/29 (17%)
TPR 3 101..134 4/32 (13%)
AdoMet_MTases 148..>303 CDD:327401 53/155 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.