DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and OMS1

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_010602.3 Gene:OMS1 / 851911 SGDID:S000002724 Length:471 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:71/338 - (21%)
Similarity:123/338 - (36%) Gaps:107/338 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DDEKMDGN-----HTDANQIIKDRRRQEE-------------HYFKLYGRIEIHEWLLKDSVR-- 52
            ||:|....     ..::|::|:.::.:||             :.|..:|.|...|...|...:  
Yeast    45 DDDKSKKKLKNVFQMNSNRVIRKQKTKEELAKERFEEQLRSPNRFVRWGAIARSEKFSKGMTKYM 109

  Fly    53 IKAYREAIQHNEFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRV 117
            |.||...:.:..||..|             :||.....:|:|.         .|:....||:..:
Yeast   110 IGAYVIFLIYGLFFTKK-------------LFAKDKELERLLK---------KQEEGNANEYEAL 152

  Fly   118 -IQVIQGKV---EDIEL-------PDGIKKVDIIVCDWMGSCLFSGNML-ESLLFARDKWLSATG 170
             |:.::||:   ::::|       .:||:..|.|...     .|..|.| |.:|.|||     |.
Yeast   153 RIKELKGKLRRRDELKLEEYKKMQEEGIENFDDIRVQ-----NFDQNKLNEQILPARD-----TT 207

  Fly   171 HIYPDTAQLYLAAIKGRDQ--DLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQM---------- 223
            :.|.:.|..|..||...::  .||             :||   |.:::|..||.:          
Yeast   208 NFYQEKANEYDKAINMEERVIFLG-------------KRR---KWLMKHCQGDVLEVSCGTGRNI 256

  Fly   224 ----MSRVCLVKSLDLYTEPRQSAKSRSLFEL--KVSRNGWVHGLVAYFDVGFSKSTQRISFSTS 282
                |||:..:..||         .|.::.|:  |..|..:.......|.||.:::...::....
Yeast   257 KYLDMSRINSITFLD---------SSENMMEITHKKFREKFPKYKKVAFVVGKAENLVDLAEKGK 312

  Fly   283 PSAPWTHWNQTVF 295
            ||......||..:
Yeast   313 PSLENEKENQVKY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 15/90 (17%)
OMS1NP_010602.3 Methyltransf_25 245..355 CDD:404528 16/90 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.