DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT10

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_563720.1 Gene:PRMT10 / 839393 AraportID:AT1G04870 Length:383 Species:Arabidopsis thaliana


Alignment Length:364 Identity:112/364 - (30%)
Similarity:184/364 - (50%) Gaps:56/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAI-QHNEFFRHKTVLDVGCGMGVLSMFAAKA 88
            |:......||..|..:...:.:|.|.||:.||..|: |:...|..|||||||.|.|:|::::|:|
plant    27 DKEVDYAQYFCTYSFLYHQKDMLSDRVRMDAYFNAVFQNKHHFEGKTVLDVGTGSGILAIWSAQA 91

  Fly    89 GSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGN 153
            |:::|.||||..:::.|:.:|:.|....:::||:|.||||.||:   |||:|:.:|||..|...:
plant    92 GARKVYAVEATKMADHARALVKANNLDHIVEVIEGSVEDISLPE---KVDVIISEWMGYFLLRES 153

  Fly   154 MLESLLFARDKWLSATGHIYPDTAQLYLAAIKGR---------DQDLGFWHD-------VHGFDL 202
            |.:|::.|||:||..||.:||..|:::||.||..         |..:..||:       .:|.|:
plant   154 MFDSVISARDRWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMADWHNFSDEIKSYYGVDM 218

  Fly   203 SAIRRRCESK--------AVVEHVTGDQMMSRVCLVKSLDLYT-------EPRQSAKSRSLFELK 252
            ..:.:....:        |:...:...|::....:||.:|..|       |.|.:.  .|:..::
plant   219 GVLTKPFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTASVSEIEEVRSNV--TSVINME 281

  Fly   253 VSR----NGWVHGLVAYFDVGFS-----KSTQRISFSTSPSAP-WTHWNQTVFYLETPLPVRAGE 307
            .:|    .||       |||.||     .:.|.|..:|:||.. .|||.|.||.:..|:.|..|:
plant   282 HTRLCGFGGW-------FDVQFSGRKEDPAQQEIELTTAPSEQHCTHWGQQVFIMSNPINVEEGD 339

  Fly   308 CIKGVLTMKPSEDSIFDTEFDIFVNFDGREKSVTIHQSF 346
            .:...|.|..|:::  ....:|.:|.:.:|.|....:||
plant   340 NLNLGLLMSRSKEN--HRLMEIELNCEIKEASGNPKESF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 36/79 (46%)
PRMT10NP_563720.1 Methyltransf_25 74..170 CDD:379312 43/98 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.