DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT4A

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_199713.2 Gene:PRMT4A / 834961 AraportID:AT5G49020 Length:528 Species:Arabidopsis thaliana


Alignment Length:348 Identity:111/348 - (31%)
Similarity:176/348 - (50%) Gaps:54/348 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EELAKDDEKMDGNHTDANQII---------KDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYRE 58
            ||..|||....|:......::         |......:.||..||::...:.:|:|.||...|..
plant   112 EECKKDDAVKQGSALPNGTVVSANKSKFDDKIEAASAKMYFHYYGQLLHQQNMLQDYVRTGTYHA 176

  Fly    59 AIQHNEF-FRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNE-FGRVIQVI 121
            |:..|.. |..:.|:|||.|.|:||||||.||:|.|.||||:.::|:|::::..|. ....|.||
plant   177 AVMENRSDFSGRVVVDVGAGSGILSMFAALAGAKHVYAVEASEMAEYARKLIAGNPLLAERITVI 241

  Fly   122 QGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAA--- 183
            :||:||||||:   |.|:::.:.||:.|.:..|||:.:.|||::||..|.::|...::::|.   
plant   242 KGKIEDIELPE---KADVLISEPMGTLLVNERMLETYVIARDRFLSPNGKMFPTVGRIHMAPFAD 303

  Fly   184 ----IKGRDQDLGFW--HDVHGFDLSAI----RRRCESKAVVE-------------HVTGDQMMS 225
                ::..::.| ||  .:.:|.||:.:    .:...|:.||:             ||....||:
plant   304 EFLFVEMANKAL-FWQQQNYYGVDLTPLYVSAHQGYFSQPVVDAFDPRLLVAPSMFHVIDFTMMT 367

  Fly   226 RVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAPWTHW 290
            .....: :|:..:...|..:|            :|||..:|||.|..||.:..|:|:|.||.|||
plant   368 EEQFYE-IDIPLKFTASVCTR------------IHGLACWFDVLFDGSTVQRWFTTAPGAPTTHW 419

  Fly   291 NQTVFYLETPLPVRAGECIKGVL 313
            .|....|..|:.|.||:.|.|.|
plant   420 YQIRCVLSQPIHVMAGQEITGRL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 38/80 (48%)
PRMT4ANP_199713.2 SmtA 140..400 CDD:223574 85/276 (31%)
AdoMet_MTases 160..>300 CDD:302624 57/142 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.