DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT6

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001326463.1 Gene:PRMT6 / 821541 AraportID:AT3G20020 Length:443 Species:Arabidopsis thaliana


Alignment Length:332 Identity:115/332 - (34%)
Similarity:178/332 - (53%) Gaps:46/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YFKLYGRIEIHEWLLKDSVRIKAYREAI-QHNEFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAV 96
            ||..|..:.|||.::||..|.:.||||| ||......|.|:|||||.|:||:|.|:||:|||.||
plant    83 YFHSYAHVGIHEEMIKDRARTETYREAIMQHQSLIEGKVVVDVGCGTGILSIFCAQAGAKRVYAV 147

  Fly    97 EAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFA 161
            :|:.|:..|::||:.|.....:.|:.|:|||:|:.:   :||:|:.:|||..|...:||.|::.|
plant   148 DASDIAVQAKEVVKANGLSDKVIVLHGRVEDVEIDE---EVDVIISEWMGYMLLYESMLGSVITA 209

  Fly   162 RDKWLSATGHIYPDTAQLYLAAIKGRDQ---DLGFWHDVHGFDLSA---IRRRCE-SKAVVEHVT 219
            ||:||...|.|.|..|.||:|.|...|:   .:.||.:|:|.|:||   :.::|. .:..||.::
plant   210 RDRWLKPGGLILPSHATLYMAPISHPDRYSHSIDFWRNVYGIDMSAMMQLAKQCAFEEPSVESIS 274

  Fly   220 GDQMMSRVCLVKSLDLYTEPRQSAKS-RSLFELKVSRNGWVHGLVAYFDVGFS-------KSTQR 276
            |:.:::...:||.:|..|...|...| .:.::........:||...:|||.||       |:|..
plant   275 GENVLTWPEVVKHIDCKTIKIQELDSVTARYKFNSMMRAPMHGFAFWFDVEFSGPASSPAKNTSE 339

  Fly   277 IS---------------------------FSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLT 314
            .|                           .||||.:|.|||.||:.|...|:.|...:.|:|.:|
plant   340 TSIASGSSSISPSGEVNQKKRTNPSDALVLSTSPESPPTHWQQTIVYFYDPIDVEQDQVIEGSVT 404

  Fly   315 MKPSEDS 321
            :..|:::
plant   405 LSQSKEN 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 36/79 (46%)
PRMT6NP_001326463.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.