DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT3

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_187835.2 Gene:PRMT3 / 820407 AraportID:AT3G12270 Length:601 Species:Arabidopsis thaliana


Alignment Length:348 Identity:119/348 - (34%)
Similarity:179/348 - (51%) Gaps:50/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LEELAKDDEKMDGNHT-----DANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQ 61
            |::.:.||..::|...     |...:.::.|:..|:||..|....||..:|.|.||.:|||:|:.
plant   209 LKQSSADDLIVNGKDAEPKVCDGRLVNRNIRKVNENYFGSYSSFGIHREMLSDKVRTEAYRDALL 273

  Fly    62 HN-EFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEA-------ATISEFAQQVVQDNEFGRVI 118
            .| .......|:|||||.|:||:||||||:.||:||||       ||......:|..|||...|:
plant   274 KNPTLLNGSVVMDVGCGTGILSLFAAKAGASRVVAVEASEKMAKVATKIAKDNKVFNDNEHNGVL 338

  Fly   119 QVIQGKVEDIELPDGIK--KVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYL 181
            :|....||:::....|:  .||::|.:|||.||...:||.|:|:|||:||...|.|.||||.:::
plant   339 EVAHSMVEELDKSIQIQPHSVDVLVSEWMGYCLLYESMLSSVLYARDRWLKPGGAILPDTATMFV 403

  Fly   182 AAIKGRDQDLGFWHDVHGFDLSAIRRRCESKA----VVEHVTGDQMMSRVCLVKSLDLYT----- 237
            |........|.||.||:|||:|:|.:......    :|:.:....::::..|:::.||.|     
plant   404 AGFGKGATSLPFWEDVYGFDMSSIGKEIHDDTTRLPIVDVIAERDLVTQPTLLQTFDLATMKPDE 468

  Fly   238 ---------EPRQS-AKSRSLFELKVSRNGWVHGLVAYFDVGFS----KSTQRISFSTSPSAPWT 288
                     ||.:| ||:|           ..||:|.:||.||:    |....: .||||..|.|
plant   469 VDFTATATLEPTESEAKTR-----------LCHGVVLWFDTGFTSRFCKENPTV-LSTSPYTPPT 521

  Fly   289 HWNQTVFYLETPLPVRAGECIKG 311
            ||.||:...:.|:.|.....:.|
plant   522 HWAQTILTFQEPISVAPASVLSG 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 39/88 (44%)
PRMT3NP_187835.2 zf-C2H2_2 57..>112 CDD:403839
AdoMet_MTases 232..>330 CDD:418430 40/97 (41%)
Methyltransf_25 284..392 CDD:404528 49/107 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.