DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT4B

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_850528.1 Gene:PRMT4B / 819878 AraportID:AT3G06930 Length:535 Species:Arabidopsis thaliana


Alignment Length:303 Identity:107/303 - (35%)
Similarity:162/303 - (53%) Gaps:33/303 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YFKLYGRIEIHEWLLKDSVRIKAYREAIQHNEF-FRHKTVLDVGCGMGVLSMFAAKAGSKRVLAV 96
            ||..||::...:.:|:|.||...|..|:..|.. |..:.|:|||.|.|:||||||:||:|.|.||
plant   148 YFHYYGQLLHQQNMLQDYVRTGTYYAAVMENHSDFAGRVVVDVGAGSGILSMFAAQAGAKHVYAV 212

  Fly    97 EAATISEFAQQVVQDNE-FGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLLF 160
            ||:.::|:|::::..|. |...|.||:|||||||||:   |.||::.:.||:.|.:..||||.:.
plant   213 EASEMAEYARKLIAGNPLFADRITVIKGKVEDIELPE---KADILISEPMGTLLVNERMLESYVI 274

  Fly   161 ARDKWLSATGHIYPDTAQLYLAAIKGRDQDL--------GFW--HDVHGFDLSAIRRRCE----S 211
            |||::::..|.::|...::::|...  |:.|        .||  .:.:|.||:.:.....    |
plant   275 ARDRFMTPKGKMFPTVGRIHMAPFS--DEFLFIEMANKAMFWQQQNYYGVDLTPLYGSAHQGYFS 337

  Fly   212 KAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKV------SRNGWVHGLVAYFDVGF 270
            :.||     |....|: ||.|...:.......|....:|:.:      |....:|||..:|||.|
plant   338 QPVV-----DAFDPRL-LVASPMFHMIDFTQMKEEDFYEIDIPLKFTASMCTRMHGLACWFDVLF 396

  Fly   271 SKSTQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVL 313
            ..||.:...:|:|.||.|||.|....|..|:.|.||:.|.|.|
plant   397 DGSTVQRWLTTAPGAPTTHWYQIRCVLSQPIYVMAGQEITGRL 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 41/80 (51%)
PRMT4BNP_850528.1 AdoMet_MTases 157..>297 CDD:302624 59/142 (42%)
PRMT5 <186..436 CDD:282971 92/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.