DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and PRMT1A

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_179557.1 Gene:PRMT1A / 816486 AraportID:AT2G19670 Length:366 Species:Arabidopsis thaliana


Alignment Length:338 Identity:136/338 - (40%)
Similarity:212/338 - (62%) Gaps:9/338 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DEKM-DGNHTDANQIIKDRRRQEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNEF-FRHKTV 71
            ||.| ||:  |.|..:.|.....::||..|....|||.:|||.||.|:|::.|..|:| .:.|.|
plant    25 DESMHDGD--DNNADVADDITSADYYFDSYSHFGIHEEMLKDVVRTKSYQDVIYKNKFLIKDKIV 87

  Fly    72 LDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKK 136
            ||||.|.|:||:|.||||:..|.|||.:.:::.|:::|:.|.|..||.|::||:|:||||  :.|
plant    88 LDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSDVITVLKGKIEEIELP--VPK 150

  Fly   137 VDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAIKG---RDQDLGFWHDVH 198
            ||:|:.:|||..|...|||:::|:||:|||...|.:.||.|.||:.||:.   :|..:.||.||:
plant   151 VDVIISEWMGYFLLYENMLDTVLYARNKWLVDGGIVLPDKASLYVTAIEDAHYKDDKVEFWDDVY 215

  Fly   199 GFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLV 263
            |||:|.|:||..::.:|:.|.|:|:::...|:|::|:.......|...:.|:|...||..:|.||
plant   216 GFDMSCIKRRAITEPLVDTVDGNQIVTDSKLLKTMDISKMAAGDASFTAPFKLVAQRNDHIHALV 280

  Fly   264 AYFDVGFSKSTQRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFD 328
            |||||.|:...:::.|||.|.:..|||.|||.|||..|.:..||.|.|.:|:..::.:..|.:..
plant   281 AYFDVSFTMCHKKMGFSTGPKSRATHWKQTVLYLEDVLTICEGETITGSMTIAQNKKNPRDVDIK 345

  Fly   329 IFVNFDGREKSVT 341
            :..:.:|:..:::
plant   346 LSYSLNGQHCNIS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 39/79 (49%)
PRMT1ANP_179557.1 AdoMet_MTases 87..187 CDD:100107 50/101 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.