DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and NDUFAF5

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_077025.2 Gene:NDUFAF5 / 79133 HGNCID:15899 Length:345 Species:Homo sapiens


Alignment Length:148 Identity:33/148 - (22%)
Similarity:56/148 - (37%) Gaps:42/148 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LDVGCGMGVLSMF-------------AAKAGSKRVLAVEAATISEFAQQ---VVQDNEFGRVIQV 120
            ||:|||.|.::.:             .|:...|.....|..|:|..|.:   ..::|.|..|:..
Human    94 LDLGCGRGYIAQYLNKETIGKFFQADIAENALKNSSETEIPTVSVLADEEFLPFKENTFDLVVSS 158

  Fly   121 IQ-----------GKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESL-----LFARDKWLSAT 169
            :.           .::..|..|||:         ::|: :|.|:.|..|     |...::....:
Human   159 LSLHWVNDLPRALEQIHYILKPDGV---------FIGA-MFGGDTLYELRCSLQLAETEREGGFS 213

  Fly   170 GHIYPDTAQLYLAAIKGR 187
            .||.|.||...|..:.||
Human   214 PHISPFTAVNDLGHLLGR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 20/104 (19%)
NDUFAF5NP_077025.2 BioC 74..310 CDD:273953 33/148 (22%)
Methyltransf_11 94..185 CDD:285453 19/99 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.