DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and prmt2

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_012826019.1 Gene:prmt2 / 780163 XenbaseID:XB-GENE-980934 Length:634 Species:Xenopus tropicalis


Alignment Length:339 Identity:110/339 - (32%)
Similarity:185/339 - (54%) Gaps:31/339 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QEEHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHN-EFFRHKTVLDVGCGMGVLSMFAAK-AGSK 91
            |:|.|:..|..:::|..:|.|..|..||:|.|..| .....|.:||:|||.|::|.|.|| |..:
 Frog   302 QDEEYYGSYKTLKLHLEMLSDVPRTTAYKEVILRNSSSLCGKHILDLGCGTGIISFFCAKLAQPE 366

  Fly    92 RVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLE 156
            .|.||||:.|:|..:::|:.|....::.||:.:.|:::||   .||||:|.:|||:||....|||
 Frog   367 AVYAVEASEIAEQTRRLVKQNGISNLVHVIRQRAEELQLP---TKVDILVSEWMGTCLLFEFMLE 428

  Fly   157 SLLFARDKWLSATGHIYPDTAQLYL---AAIKGRDQDLGFWHDVHGFDLSAIR----RRCESKAV 214
            |:|.|||:||...|.::|.||.::|   :|.|.....:.||.:.:..|.|.::    :...::..
 Frog   429 SVLQARDRWLKEDGVMWPSTACIHLVPCSASKEYANKVLFWDNPYQLDFSLLKPLAAKEFFARPK 493

  Fly   215 VEHV-TGDQMMSRVCLVKSLDLYT-EPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQ-- 275
            .::| ..:..:|..|::..|:|.| :..:..:..|.|...|..:|.:||..|:|.|.|....:  
 Frog   494 PDYVLQPEDCLSEPCILLHLNLKTLQLAELERMNSDFTFFVHTDGLLHGFTAWFSVQFQNLEEQG 558

  Fly   276 RISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGREKSV 340
            ::..:|.|.:|.|||..|:|.|:.||.|:.|:.|.|.:..:  .:|::           .|..||
 Frog   559 QLELNTGPFSPLTHWKHTLFMLDEPLQVQKGDKISGSVVFQ--RNSVW-----------RRHMSV 610

  Fly   341 TIHQSFVLSDPLTL 354
            |:  |:|::..||:
 Frog   611 TL--SWVINGKLTM 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 34/80 (43%)
prmt2XP_012826019.1 2A1904 <22..>232 CDD:273344
SH3 235..287 CDD:388381
Methyltransf_25 345..442 CDD:379312 45/99 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.