DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Prmt3

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_598501.1 Gene:Prmt3 / 71974 MGIID:1919224 Length:528 Species:Mus musculus


Alignment Length:322 Identity:125/322 - (38%)
Similarity:195/322 - (60%) Gaps:11/322 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LEELAKD-DEKMDGNHTDANQIIKDRRRQEEH-YFKLYGRIEIHEWLLKDSVRIKAYREAIQHN- 63
            :::.|:| ...:|.....:...|.|.:..|:. ||..||...|||.:|||.||.::||:.|..| 
Mouse   184 MKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNP 248

  Fly    64 EFFRHKTVLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDI 128
            ..|:.|.|||||||.|:|||||||.|:|:|:||:.:.|...|..:::.|:....|.:|:||:|::
Mouse   249 HIFKDKVVLDVGCGTGILSMFAAKVGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEV 313

  Fly   129 ELPDGIKKVDIIVCDWMGSCLFSGNMLESLLFARDKWLSATGHIYPDTAQLYLAAI----KGRDQ 189
            .||  ::|||:|:.:|||..|...:||:|:|:|:.|:|:..|.:|||...:.|.|:    |..|:
Mouse   314 SLP--VEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADR 376

  Fly   190 DLGFWHDVHGFDLSAIRRRCESKAVVEHVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVS 254
             :.||.||:||::|.:::....:||||.|....::|..|.:|.:|.:|......:..|.|.|:.:
Mouse   377 -IAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTT 440

  Fly   255 RNGWVHGLVAYFDVGFSKST-QRISFSTSPSAPWTHWNQTVFYLETPLPVRAGECIKGVLTM 315
            :......:..|||:.|.|:. .|:.|||.|.:..|||.||||.||.|.||:|||.:||.:|:
Mouse   441 KTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFPVKAGEALKGKITV 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 37/79 (47%)
Prmt3NP_598501.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 46/101 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.