DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Prmt8

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001258314.1 Gene:Prmt8 / 688502 RGDID:1587677 Length:394 Species:Rattus norvegicus


Alignment Length:317 Identity:140/317 - (44%)
Similarity:215/317 - (67%) Gaps:8/317 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EHYFKLYGRIEIHEWLLKDSVRIKAYREAIQHNE-FFRHKTVLDVGCGMGVLSMFAAKAGSKRVL 94
            ::||..|....|||.:|||.||...||.::.||: .|:.|.|||||.|.|:|||||||||:|:|.
  Rat    74 DYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVF 138

  Fly    95 AVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESLL 159
            .:|.::||::::::::.|....||.:.:||||::|||  ::|||||:.:|||.|||..:||.:::
  Rat   139 GIECSSISDYSEKIIKANHLDNVITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVI 201

  Fly   160 FARDKWLSATGHIYPDTAQLYLAAIKGR---DQDLGFWHDVHGFDLSAIRRRCESKAVVEHVTGD 221
            |||||||...|.::||.|.||:.||:.|   |..:.:|.:|:|||::.||.....:.:|:.|...
  Rat   202 FARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPK 266

  Fly   222 QMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFSTSPSAP 286
            |:::..||:|.:|:||...:.....|.|.|::.||.:||.||.||::.|:|..:::.|||:|.||
  Rat   267 QVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAP 331

  Fly   287 WTHWNQTVFYLETPLPVRAGECIKGVLTMKPSEDSIFDTEFDIFVNFDGR--EKSVT 341
            :|||.|||||||..|.||.||.|.|.::|||:..::.|.:|.:.::|.|:  |.||:
  Rat   332 YTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 40/79 (51%)
Prmt8NP_001258314.1 AdoMet_MTases 115..215 CDD:100107 52/101 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11006
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.