powered by:
Protein Alignment Art2 and Mettl27
DIOPT Version :9
Sequence 1: | NP_001285600.1 |
Gene: | Art2 / 33631 |
FlyBaseID: | FBgn0031592 |
Length: | 355 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102969.1 |
Gene: | Mettl27 / 688407 |
RGDID: | 1588881 |
Length: | 253 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 31/71 - (43%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 VLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIK 135
:|||.||.|::::.....|..:|..|:.: .|..:|......:..:.....|: |.:..|.|..
Rat 71 ILDVACGTGLVAVELQARGFLQVQGVDGS--PEMLKQARARGLYHHLSLCTLGQ-EPLPYPKGTF 132
Fly 136 KVDIIV 141
...|||
Rat 133 DAVIIV 138
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.