DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Mettl27

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001102969.1 Gene:Mettl27 / 688407 RGDID:1588881 Length:253 Species:Rattus norvegicus


Alignment Length:71 Identity:18/71 - (25%)
Similarity:31/71 - (43%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLDVGCGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKVEDIELPDGIK 135
            :|||.||.|::::.....|..:|..|:.:  .|..:|......:..:.....|: |.:..|.|..
  Rat    71 ILDVACGTGLVAVELQARGFLQVQGVDGS--PEMLKQARARGLYHHLSLCTLGQ-EPLPYPKGTF 132

  Fly   136 KVDIIV 141
            ...|||
  Rat   133 DAVIIV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 18/71 (25%)
Mettl27NP_001102969.1 Methyltransf_25 71..162 CDD:404528 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.