DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Gstcd

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001343238.1 Gene:Gstcd / 67553 MGIID:1914803 Length:634 Species:Mus musculus


Alignment Length:153 Identity:28/153 - (18%)
Similarity:45/153 - (29%) Gaps:60/153 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 HIYP-------DTAQLYLAAIKGRDQDLG---FW-------HDVHGFDLSAIRRRC--ESKAVVE 216
            |:.|       :..:|.|...|.|..:||   .|       :....|::......|  .:..|:|
Mouse   462 HMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVALHACGVATDMVIE 526

  Fly   217 HVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQRISFST 281
            |          |:.......|.|                       ..|   ||.::|.:.:|..
Mouse   527 H----------CIQTRASFITCP-----------------------CCY---GFIQNTSKFNFPK 555

  Fly   282 SPSAPWTHWNQTVFYLETPLPVR 304
            |..     :.:|:.|.|..|..|
Mouse   556 SEK-----FKKTLSYKEHMLLCR 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107
GstcdNP_001343238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..233
GST_C_family <271..330 CDD:322082
AdoMet_MTases 424..542 CDD:327401 17/112 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.