DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art2 and Mettl7a3

DIOPT Version :9

Sequence 1:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001074940.1 Gene:Mettl7a3 / 668178 MGIID:3710670 Length:244 Species:Mus musculus


Alignment Length:113 Identity:29/113 - (25%)
Similarity:49/113 - (43%) Gaps:22/113 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WLLKDSVRIKAYREAIQHNEFFRH----------KTVLDVGCGMGVLSMFAAKAGSKRVLAVEA- 98
            :.||....|..::.|....|.|.:          .|:|:||||.|  :.|.......||..::. 
Mouse    38 YFLKRFAMIYNWKMASLKQELFSNLQEFAGPSGKLTLLEVGCGTG--ANFKFYPPGCRVTCIDPN 100

  Fly    99 ATISEFAQQVVQDN---EFGRVIQVIQGKVEDI-ELPDGIKKVDIIVC 142
            ....:|..:.|.:|   :|.|.:..:.   ||: ::.||  .||::||
Mouse   101 PNFEKFLFKSVAENRQLQFERFVVAVG---EDMHQVTDG--SVDVVVC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 23/78 (29%)
Mettl7a3NP_001074940.1 Methyltransf_11 75..172 CDD:285453 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.