DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Art2 and ANTKMT

DIOPT Version :9

Sequence 1:	NP_001285600.1	Gene:	Art2 / 33631	FlyBaseID:	FBgn0031592	Length:	355	Species:	Drosophila melanogaster
Sequence 2:	NP_076422.1	Gene:	ANTKMT / 65990	HGNCID:	14152	Length:	235	Species:	Homo sapiens

Alignment Length:	142	Identity:	28/142 - (19%)
Similarity:	45/142 - (31%)	Gaps:	64/142 - (45%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 RQEEHYFKLY--------------GRI---------------EIHEWLLKDSVRIKAYREAIQHN 63
            ||.||...|.              |||               |::.||:. ..|:.|:|.....:
Human    63 RQVEHVLSLLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVA-LARLHAWRAGCAGS 126

  Fly    64 EFFRHKTVLDVG---CGMGVLSMFAAKAGSKRVLAVEAATISEFAQQVVQDNEFGRVIQVIQGKV 125
            ..:|.|.:..|.   |..  :|:|.|.:                            |:.:::.|:
Human   127 VCYRRKDLWKVSLRDCRN--VSVFLAPS----------------------------VLPLLEDKL 161

  Fly   126 EDIELPDGIKKV 137
            . .|||.|.:.|
Human   162 R-TELPAGARVV 172

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Art2	NP_001285600.1	AdoMet_MTases	70..>150	CDD:100107	12/71 (17%)
ANTKMT	NP_076422.1	N-terminal sequence (NTS). /evidence=ECO:0000303\|PubMed:31213526	1..22
		Methyltransferase (MTase). /evidence=ECO:0000303\|PubMed:31213526	43..77		5/13 (38%)
		Pre-methyltransferase (preMT). /evidence=ECO:0000303\|PubMed:31213526	43..77		5/13 (38%)
		HemK	<65..>123	CDD:225443	12/58 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	215..235
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900